CAZyme Information: MGYG000003437_00963

Basic Information

• Species: Eubacterium_R sp900767025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900767025
• CAZyme ID: MGYG000003437_00963
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000003437_48|CGC1	87936.9	5.2033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003437	2166830	MAG	Fiji	Oceania

• Gene Location: Start: 3454; End: 5826 Strand: -

Full Sequence      

MNIKNKINTTIQKIIDKVSGSGVMQEENNANGEKFIFPGMPQVALKAAQESTVLLKNNEA
LPIKDETVSLFGRCQLDWFYVGYGSGGDVNAPYQVNLVQGLENNNVKLNTELLEIYKKWC
ADNPVNHGFWGHWPMHYPEMELNESVVTSASKKSETAVIVIGRAAGEDRENTLEKGSFYL
TDTEVNMLDLVTAHFSKTVVIMNCGNIVDMSWTKEYDDKINAIIYAWQCGMESGNAVADV
LTGKVNPCGKLTDTIAMNYEDYPSSSDFGNADFNNYSEDIFVGYRYFETFDNSKVLYPFG
FGLSYTDFEIKEKNFAFDGDEFSVTVTVKNVGDTAGKEVVQIYCTAPEGKLKKAEKSLVA
FAKTDLLEPDAEQELTISFDIYSISSFDEDIYSYIIEEGEYIFTVGNSVANTAFSCTQSL
DYKVVRELSSICPVQNRFKMITGQWAEPAKPVLKERILKNLPKEIGFKGDKGYKLDDVKN
GKITLDEFISQLNNTELEALTRGQGKMDSEHGVAGNAGAFGGIIPSLREKGVPPIITTDG
PAGIRIKKYTSLIPCGTALACTWNTALVEELASVMGKELAYQKSDVLLAPGMNIHRNVLC
GRNFEYFSEDPLVSGKMAAAFVRGVQSGGGSACPKHFACNNQEFKRTKNDSRVTQRALRE
IYLKGFEICVKESEPLNIMTSYNKINGVWSHYNYDLVTTVLRGEWGYKGNVMTDWWMQKS
PSPEFPNIKDNAYRVRSQVDVLMPGGIKRLEKKYKSDGSLLKTLGKPEGITRGELERTAK
NVLTLALKIK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	530	743	3.9e-64	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.97e-51	531	753	59	289	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	7.81e-41	52	284	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	3.98e-32	44	406	387	751	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	2.12e-23	531	715	65	255	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.94e-18	483	714	60	297	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ18913.1	5.06e-286	3	789	5	806
AZS42860.1	6.12e-279	38	790	38	809
SCY66942.1	1.58e-271	38	790	38	809
APZ35313.1	1.78e-269	38	789	38	827
VEP40216.1	2.66e-265	12	783	10	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	3.01e-202	39	787	35	820	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X42_A	1.04e-66	42	420	326	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	1.04e-66	42	420	326	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	6.85e-47	531	715	36	232	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.20e-44	524	715	29	233	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	3.28e-186	46	787	12	763	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	2.90e-142	42	716	30	771	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q5BFG8	2.77e-47	529	789	40	289	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
B0Y8M8	4.19e-47	475	745	4	254	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
Q4WLY1	4.19e-47	475	745	4	254	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003437_00963.