CAZyme Information: MGYG000003438_00941

Basic Information

• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae
• CAZyme ID: MGYG000003438_00941
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		41926.96	9.0281

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003438	1357113	MAG	Fiji	Oceania

• Gene Location: Start: 1767; End: 2840 Strand: -

Full Sequence      

MTKKQVRIACMDGVGYDIVSWFSSVLGKYSENGISEFEFVQDEKNPQFIIYSVFSTRHIH
YDCVRIFYTAENCRADFNFCDYAITYDYMDFEDRHLRYPLYLNNLACLDKNSALYQKSNF
GSEFAKRKFCSFVVSNGKADELRSKVFDALNAYKRVDSAGKFKNNMGFLAGDKIAFLKDY
KFNICFENCYTNGYITEKIIDAKKANSVPIYWGGGICKNESNRLKSRSFESLRESDGVVF
NKNAFVNLADFSSIDEMLEFVKYLDNDKNAYLAMLNEPLILDSQILEKNDKKLAEFLRNI
FSAENPYCRGFGQWRMNLEKRYVRFQKTREIVNKIIDYYRKAIFLSFWKKLFGKKRK

Enzyme Prediction     

No EC number prediction in MGYG000003438_00941.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	84	282	2.8e-38	0.5244956772334294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18025	FucT_N	1.60e-22	45	103	32	91	Alpha-(1,3)-fucosyltransferase FucT N-terminal domain. This is the N-terminal domain of the alpha chain found in Helicobacter pylori Fucosyltransferase protein which is involved in the production of Lewis x trisaccharide, a major component of lipopolysaccharide. The N-terminal domain contains the catalyst base, Glu-95 which is equivalent to the Asp-100 of other members of the glycosyltransferases-B family. The domain contains the pocket where LacNAc binds. The domain is composed of 2-10 heptad repeats and a conserved N-terminal alpha-beta-alpha motif which has little sequence similarity to the conserved N-terminal motif in other glycosyltransferases.
pfam00852	Glyco_transf_10	2.39e-12	126	272	1	131	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUU40098.1	1.90e-90	45	337	44	326
BAM12149.1	5.05e-89	24	333	14	315
BBB19786.1	5.05e-89	24	333	14	315
QOQ91624.1	1.43e-88	24	333	14	315
AAP78373.1	3.54e-87	37	337	34	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.06e-43	65	307	89	345	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	2.14e-42	65	307	89	345	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30511	4.52e-42	65	307	89	345	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q5UQ63	2.92e-14	126	304	423	593	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
P21217	3.51e-08	125	322	188	350	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
O19058	3.63e-08	125	322	199	361	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Pan troglodytes OX=9598 GN=FUT3 PE=3 SV=1
Q11128	3.66e-08	125	322	201	363	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003438_00941.