CAZyme Information: MGYG000003440_02139

Basic Information

• Species: Anaerobiospirillum succiniciproducens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Anaerobiospirillum; Anaerobiospirillum succiniciproducens
• CAZyme ID: MGYG000003440_02139
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000003440_129|CGC1	37820.59	9.048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003440	3625053	MAG	Fiji	Oceania

• Gene Location: Start: 2994; End: 4064 Strand: -

Full Sequence      

MSKRVLVMAGGTGGHVFPAMAIVKELQSRGHTVEWLGTRGRIEERVVPAAGINIHYIDVK
GVRRNGIMSLLKAPFMVMHAVSQAKKVIKEFKPDVVIGFGGYASGPGGVAASLSGIPLIL
HEQNAAAGLTNRLLSRFASKILLGVGNAFNGPKVESVGNPVRSEILALHSQERSFEREDG
KTRILVIGGSLGAVALNKAVPAALEGFNDNEVSVFHQCGKDRSEETAQLYKNVKCEFVTS
DFVEDMASAYRNADLIICRAGASTVSEVSAAKLPAIFVPLPTAVDDHQTKNAQSLVSVGA
AKLLPQSELTSEALHQLIVELRNPQVLKAMSEAAAKAAKLDATTRVADIAEELANK

Enzyme Prediction     

No EC number prediction in MGYG000003440_02139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	184	341	3.1e-52	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	9.56e-158	2	356	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.60e-141	4	323	1	323	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	4.52e-128	3	327	1	325	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	1.93e-123	3	356	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	3.69e-51	5	142	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUM87560.1	2.94e-118	1	353	1	351
QUM83258.1	2.94e-118	1	353	1	351
QUM78219.1	3.38e-117	1	353	1	351
CED62062.1	3.99e-117	1	353	6	356
QUM79055.1	6.79e-117	1	353	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	6.56e-101	3	353	10	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	9.67e-98	1	354	1	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	2.84e-91	3	348	7	348	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SI56	1.95e-114	1	354	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=murG PE=3 SV=1
A8H984	5.12e-113	3	356	8	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=murG PE=3 SV=1
B0TQN7	2.06e-112	3	356	8	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=murG PE=3 SV=1
A3QIM1	3.24e-111	3	356	5	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=murG PE=3 SV=1
Q12SC6	9.83e-111	1	356	6	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) OX=318161 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003440_02139.