CAZyme Information: MGYG000003442_01723

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium
• CAZyme ID: MGYG000003442_01723
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000003442_206|CGC1	44340.06	4.7693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003442	2188754	MAG	Fiji	Oceania

• Gene Location: Start: 2747; End: 3916 Strand: +

Full Sequence      

MKRNGFITLALLCAMSMAAPAQAGTWLQDGTTWMYQKDQGQMAAGEWVQDTDQRWYYFDQ
NGRMLRNSITSDGYVLGADGAYIPGMGQDQDSALSPWTYQQLLGRGMDVDWSKTSKGRSL
YQTKVVEDFKSAGVDHVRIRVKDDLTSEQLLMLKQQITDCLNHGIIPILAYQADAFKNQA
NQETIQGVVNWWRTMATYFQSTSHLLAFDLMIECTDELNKRPDILNQMIEQTVTAIRETN
PDRIIMMSPRVRSAPEYLSELQVPTKGNGYMMAEWHFYASGPSKTNPKKLWTTGTAEEQQ
LIWQKIQYALQWQQQTGIPTWVGAWMAGDYNEENQYTLAEQIQFASFVCQALDAAGIPFA
VNADSHFYNREAGTWYAEMAPLRQLIWGN

Enzyme Prediction     

No EC number prediction in MGYG000003442_01723.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	105	360	5.4e-25	0.7781818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033838	PspC_subgroup_1	1.16e-07	18	83	620	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
pfam00150	Cellulase	3.24e-07	153	345	67	256	Cellulase (glycosyl hydrolase family 5).
COG5263	COG5263	8.71e-07	26	83	257	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033930	pneumo_PspA	1.05e-06	23	113	462	547	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033840	PspC_relate_1	3.08e-06	14	111	499	592	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	1.57e-126	91	389	2	300
QUF84801.1	1.15e-123	94	382	29	317
QMW91197.1	1.62e-123	94	382	29	317
BBK76626.1	1.62e-123	94	382	29	317
QCI58964.2	6.39e-123	89	382	26	319

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	1.68e-12	111	371	53	315	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998840	0.000220	0.000229	0.000191	0.000160

TMHMM  Annotations     

start	end
5	27