CAZyme Information: MGYG000003442_01737

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium
• CAZyme ID: MGYG000003442_01737
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	MGYG000003442_208|CGC1	35237.77	6.2603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003442	2188754	MAG	Fiji	Oceania

• Gene Location: Start: 152; End: 1084 Strand: +

Full Sequence      

MRTAWRPNTIFLNHCRHVRLQSITVKNSPSWTVHPYYTDHIGVYNITIWNPSDSPNTDGF
DPESCDDILILGTKISVGDDCIALKSGKYYMSQNHHKISDHFTIRNSFLERGHGSVTVGS
EAAGGVINVEVAQCIFDGTDRGLRIKTRRGRGPETLYDGVYFHDIIMKDVHMPFTFNMFY
FCDPDGHSDYVQNQSFHPVDDKTPTIGTIRAENIRCTGADACMLVAYGLPERYIENIVLK
NIKVDFLPKSERKPRQTIMMDHFPEMTGRAIYARNVKRLTLEDVEITGSDDTEPVLQDVL
DYDSVHVSIN

Enzyme Prediction     

No EC number prediction in MGYG000003442_01737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	6	250	7.3e-61	0.6553846153846153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	4.46e-55	6	301	237	530	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	3.34e-23	7	170	85	239	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	4.10e-17	6	222	137	347	Probable polygalacturonase At3g15720
PLN03010	PLN03010	5.98e-17	15	180	165	320	polygalacturonase
PLN02188	PLN02188	3.08e-16	46	246	194	376	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35238.1	1.33e-129	2	296	216	510
ABX43097.1	2.73e-97	4	299	219	512
CBL11994.1	6.82e-92	4	290	220	504
VCV21973.1	6.82e-92	4	290	220	504
CBL09361.1	6.82e-92	4	290	220	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	2.92e-24	6	245	189	411	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	9.37e-16	6	253	199	434	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	5.40e-45	10	231	25	247	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	2.49e-22	6	254	198	434	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P18192	1.28e-15	7	215	177	375	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P49062	4.66e-15	7	173	169	326	Exopolygalacturonase clone GBGE184 OS=Arabidopsis thaliana OX=3702 GN=PGA3 PE=2 SV=1
Q9LW07	2.30e-14	6	222	137	347	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999945	0.000094	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003442_01737.