CAZyme Information: MGYG000003445_00343

Basic Information

• Species: RC9 sp900767375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767375
• CAZyme ID: MGYG000003445_00343
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	MGYG000003445_31|CGC1	91442.56	4.8498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003445	1789928	MAG	Fiji	Oceania

• Gene Location: Start: 264; End: 2714 Strand: +

Full Sequence      

MNTLKRLLTAAAVILTGLSAAAANRFITFESGSAGVQLAGGGSVAAIAIDSANEWEGVKW
AAENLALDFERVTGVKPSVGTEGRIVIGTLGRSAAIESLLSAEEKAQLNGKREMYYIKVT
GDRVIVAGSDKRGTTYGIYAISKEIGVSPWYWWADVPAEKHSDIFAKEGLYTEGEPGVFY
RGIFLNDEAPALTGWVKENTNGYTSEFYKHVFELLLRLKGNFMWPAMWDAAFYDDDPLNM
YYADTMGIIMGTSHHEPCSRAQKEWHRYGNGAWDYTKNASTLMSFWKEGIERMKNTEDVV
TVGMRGDGDMAMSQGTNIALLEKIIKDQRKMIAKVTGKPAEKTPQVWALYKEVQDYYDEG
MRVPDDVTLLLCDDNWGNVRKLPLLDAKPRSGGYGMYYHFDYVGGPRNYKWINTNQIQRV
WEQMNLCWEYGVRKLWVVNVGDLKPVEYPIQFFLDMAWNPEAYNPSNLKAHTVDFAADTF
GEEYAEEIGDIMDLYGKYSRRVTPELLTDATYSLNYDEWPRVVGEWKELELRALRVAQKL
APEYIDAYEELVLFPVQAFGNVYEMYYAVAMNKAAEDVDEINMWADKVEAAYARDAELCA
HYNHEIAGGKWNHMMDQNHIGYFMWQEPREQRMPAVKRVNGSSPLCHLEKDGYISIEAVN
YSAKHVADDAVQVCTIKGLGKTVGAVTTLPAAVNPSEKSAYVEYSIETESAGAAALTVLL
APTLNFNQNVGLTYAVSVDGGEEMAVNFNGMYKGELGQWQANSIIESRARLDFGEPGRHT
LRFRFVSPGIVVEKIMVNFGGLKQSYLGAPSSELVK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	35	795	2.3e-264	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	174	506	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.85e-47	647	810	2	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	2.79e-04	75	140	54	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48268.1	0.0	22	816	23	819
QUT46125.1	0.0	22	816	23	819
QRQ50209.1	0.0	47	816	46	819
QIU93956.1	0.0	4	812	1	820
QDO71564.1	0.0	19	812	5	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	2.39e-254	1	807	9	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.76e-231	53	807	33	829	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	3.50e-228	53	807	32	828	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.26e-188	26	718	5	698	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.74e-125	57	639	31	658	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000624	0.998557	0.000225	0.000206	0.000188	0.000180

TMHMM  Annotations     

start	end
7	29