CAZyme Information: MGYG000003445_00384

Basic Information

• Species: RC9 sp900767375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767375
• CAZyme ID: MGYG000003445_00384
• CAZy Family: GT94
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42138.15	6.8942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003445	1789928	MAG	Fiji	Oceania

• Gene Location: Start: 8023; End: 9144 Strand: -

Full Sequence      

MKIAILSSFYPFRGGIAQFNANLYNELGSRSDVRAFTFSRQYPSFLFPGKTQYVTPDDEA
VSVESETLLDTANPFSYIRTARAIRAWDPDILILRYWMSYFGPSLGYVARHMAPKCKVVA
ILDNVIPHEPKFFDKPFTKYFLSGCDGLVTLCSEVGRDLQAFGTGKPHVTLYHPLYSHFG
DRMPRQEAEDALGLQHGKKNILFFGLIRHYKGLDILLEAFRGLGPDYQLIIAGEPYGSFD
SYQEIIDGCPGRDRIKVIPKYIKDSEVKRYFSAADLTVLPYRSATQSGISSVSYHFEVPM
VVTDVGGLKETIGDTGTGIVAESVTPECIRLEIERYFSNPSIGEACKENIRKEKERLSWG
RFTDRLLDFTLTL

Enzyme Prediction     

No EC number prediction in MGYG000003445_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT94	110	304	2.5e-22	0.6466431095406361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03822	GT4_mannosyltransferase-like	2.57e-40	2	368	1	367	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
COG0438	RfaB	3.52e-32	1	369	1	373	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	7.14e-31	2	369	1	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	4.66e-23	197	352	1	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03809	GT4_MtfB-like	8.67e-17	2	368	1	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY54189.1	3.93e-169	1	373	1	372
AZQ62941.1	2.37e-133	1	373	1	372
QWG07062.1	4.47e-130	1	373	1	372
QWG00996.1	6.53e-128	1	373	1	372
QKH99047.1	8.37e-128	1	369	1	369

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU66	2.49e-17	173	365	175	363	Low-salt glycan biosynthesis hexosyltransferase Agl5 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl5 PE=3 SV=1
Q9R9N2	2.76e-09	137	320	110	295	Lipopolysaccharide core biosynthesis mannosyltransferase LpsB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsB PE=3 SV=1
D5UJ42	4.85e-09	117	367	195	433	D-inositol 3-phosphate glycosyltransferase OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134) OX=446466 GN=mshA PE=3 SV=1
Q58577	4.92e-09	1	359	4	335	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
Q59002	5.66e-09	191	359	201	370	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998703	0.001331	0.000012	0.000002	0.000001	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003445_00384.