CAZyme Information: MGYG000003445_00925

Basic Information

• Species: RC9 sp900767375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767375
• CAZyme ID: MGYG000003445_00925
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		27990.96	10.9022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003445	1789928	MAG	Fiji	Oceania

• Gene Location: Start: 6093; End: 6821 Strand: +

Full Sequence      

MLTFVSTFRTMKKFFKFLFIKLPLALIALSVLLVVIFKWVPVWVTPIMVHRSIQYRNDPD
YHTSKKWVKLEDISPEMMKAVISSEDNLFCKHNGFDEKAIRQAIEERKSGKRIRGGSTIS
QQTAKNMFTFHGRTWWRKGVETWFTILIELFWSKERIMEVYLNIVETGKGVFGVEAASQK
YFHKSAAKLTRREACLIAAVLPSPIKRNAGRPSSYVSSRANAIARLVPKLAYPDWITRKK
GN

Enzyme Prediction     

No EC number prediction in MGYG000003445_00925.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	62	224	5.9e-52	0.9209039548022598

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	6.20e-108	24	240	17	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	5.77e-83	24	225	12	216	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.70e-64	23	226	22	239	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.27e-62	61	225	9	174	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.70e-32	68	225	70	222	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53411.1	5.88e-84	13	240	11	238
VTP89197.1	5.05e-72	24	234	36	247
SNV41705.1	7.46e-71	24	234	44	255
AVR44737.1	1.54e-70	20	225	10	212
QQX77662.1	6.04e-70	12	240	3	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.20e-27	67	208	22	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.24e-26	67	208	22	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	1.78e-22	68	204	43	178	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	3.04e-20	68	234	42	209	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	1.14e-18	68	232	42	207	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5WAE0	1.49e-64	27	236	17	227	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=mtgA PE=3 SV=1
Q88CS3	1.49e-64	27	236	17	227	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=mtgA PE=3 SV=1
B0KN61	4.24e-64	28	236	18	227	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mtgA PE=3 SV=1
Q1IGD6	3.42e-63	30	236	20	227	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=mtgA PE=3 SV=1
B8GYX9	3.89e-63	9	225	3	214	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
17	39