CAZyme Information: MGYG000003447_01403

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia
• CAZyme ID: MGYG000003447_01403
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		41514.48	7.8175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003447	1841163	MAG	Fiji	Oceania

• Gene Location: Start: 1598; End: 2710 Strand: +

Full Sequence      

MKLFMVAGEKSGDKQGALLIKELRARRPDVELEGLGGARMHELAPQIEDWADEAGVIGII
DVLKHIRFFANKLNAITRRIAEEQPDGLILIDYPGFNQRLAERIHKLCPKTKIAYFIAPM
VWAWHKSRVPKLARVLDLMMCTFPFEKPIFEKVGLRTEFVGHPLVDDILATRRTDVRQQG
LIGLFPGSRVREIERIFPVFLQVVTALHTRRPDWRFETSASTPKLADMMQRMAQQAGVPS
GLINICPGSYHDLMDRAEAALVTSGTATLEAALHELPFALVYKTAPSTYWLGRMLLTIKY
IGMVNILVDKPVTRELIQYDFNVENCIAELERLTEPESRAKVLAEMKESTDTLGHGGAAA
KAAEAVLSLF

Enzyme Prediction     

No EC number prediction in MGYG000003447_01403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	1.1e-102	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.96e-109	1	349	2	358	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.94e-104	1	345	2	353	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.25e-81	3	331	1	331	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.45e-64	5	349	10	355	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.57e-60	1	356	2	335	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEH72811.1	6.87e-163	1	369	1	369
QWP69500.1	1.24e-157	1	369	1	369
QWP04273.1	1.24e-157	1	369	1	369
QWP64696.1	1.24e-157	1	369	1	369
QWP28066.1	1.24e-157	1	369	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.49e-46	1	330	7	341	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.49e-46	1	330	7	341	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	1.71e-68	2	369	8	379	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	2.58e-67	2	369	6	377	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	5.12e-67	2	369	8	379	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.15e-65	2	369	8	379	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	5.31e-63	3	369	6	377	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003447_01403.