CAZyme Information: MGYG000003448_00157

Basic Information

• Species: RC9 sp900767405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767405
• CAZyme ID: MGYG000003448_00157
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		93084.29	6.1505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003448	1065599	MAG	Fiji	Oceania

• Gene Location: Start: 4474; End: 6966 Strand: +

Full Sequence      

MKKVLTTLSLLALGVSVFAQEQWVRINQLGYIPNSTKVAVLVSKQPSTVTEFQILDAFTG
KPVYKGTATATGEYGLLKGTWRLNFSDFCKEGTYVIKAGNAVSEAFPINGAVYNGTADLA
LYYMRQQRCGWNPYLKDSCHTKDAYIVGHPTKTGQHIDVTGGWHDATDCLQYATTSANAV
YQMMFAYLRNPESFADNFQANGTPGKNGIPDIVDEIYWGLDWMDRMNPEPGELYDQIADD
RDHMGFRRPATDKADYGYGPGNGRVVYYVTGEPRVQYTGKNMSFGAASIAGKFASDFALG
SKILAPFYPEFAARIGAKAKDAYQLGVDKPGNSQTCSIVDRYIYEETNWVDDMELGAMEL
YRQTGDRRYIDEAILYGRQEPVTPWMGADSARHYQWYPFMNMGHYLVAANATGKEKAEFI
RNLRLGIDRVYEKAQGSPFLYGVPNIWCSNNLVTAMLTQCILYRQLTGDCTYQEMEGSLR
DWLLGCNPWGTSMIIDLPVGGVYPTMPHSFITSLGLGHQTGGLVDGPVYSSIFNSLTGVN
MDGGINYLDIQPDIMVYHDSENDYSTNEPTICGTACLTFPFSAYEKEGRQTSGASVDANV
YVNGGIIRHDPSKKRICLVFTAADKADGADPIIDALHKYNIKGGFFFTGEFYEKFPKVVK
RLVKEGHYVGSHSYGHLLYSTWEDRDKMLVTKDEFKADMLKSYKLMRKFGITKQQAPYFI
PPYEHYNKTVSSWAKELGLQVINYTPGTASNGDYTTPDMKNYYSSDEIMRRIKALEEKEG
LNGHFLMIHFGTSDLRTDKFYNRIPELVEYLQAKGYEFVGVEDALGLKVK

Enzyme Prediction     

No EC number prediction in MGYG000003448_00157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	113	579	5e-74	0.9880382775119617
CE4	610	742	1.7e-20	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	3.20e-60	120	579	6	372	Glycosyl hydrolase family 9.
cd10917	CE4_NodB_like_6s_7s	1.17e-32	614	812	1	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
COG0726	CDA1	4.04e-29	577	819	28	251	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10950	CE4_BsYlxY_like	3.94e-27	610	825	2	188	Putative catalytic NodB homology domain of uncharacterized protein YlxY from Bacillus subtilis and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis putative polysaccharide deacetylase BsYlxY, encoded by the ylxY gene, which is a member of the carbohydrate esterase 4 (CE4) superfamily. Although its biological function still remains unknown, BsYlxY shows high sequence homology to the catalytic domain of Bacillus subtilis pdaB gene encoding a putative polysaccharide deacetylase (BsPdaB), which is essential for the maintenance of spores after the late stage of sporulation and is highly conserved in spore-forming bacteria. However, disruption of the ylxY gene in B. subtilis did not cause any sporulation defect. Moreover, the Asp residue in the classical His-His-Asp zinc-binding motif of CE4 esterases is mutated to a Val residue in this family. Other catalytically relevant residues of CE4 esterases are also not conserved, which suggest that members of this family may be inactive.
cd10949	CE4_BsPdaB_like	5.28e-26	612	825	2	190	Putative catalytic NodB homology domain of Bacillus subtilis putative polysaccharide deacetylase PdaB, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by the putative polysaccharide deacetylase PdaB encoded by the pdaB gene on sporulation of Bacillus subtilis. Although its biochemical properties remain to be determined, the PdaB (YbaN) protein is essential for maintaining spores after the late stage of sporulation and is highly conserved in spore-forming bacteria. The glycans of the spore cortex may be candidate PdaB substrates. Based on sequence similarity, the family members are classified as carbohydrate esterase 4 (CE4) superfamily members. However, the classical His-His-Asp zinc-binding motif of CE4 esterases is missing in this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT35459.1	0.0	22	827	23	836
QUT98069.1	0.0	22	827	23	836
QPH59586.1	0.0	22	827	23	836
QBJ19309.1	0.0	22	827	23	836
QMI80662.1	0.0	22	827	23	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	1.30e-37	20	579	14	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	8.29e-30	32	587	2	542	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
6DHT_A	4.37e-27	24	577	18	557	Bacteroidesovatus GH9 Bacova_02649 [Bacteroides ovatus ATCC 8483]
5U0H_A	6.14e-27	32	587	2	542	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
4M1B_A	6.89e-18	606	825	49	243	StructuralDetermination of BA0150, a Polysaccharide Deacetylase from Bacillus anthracis [Bacillus anthracis],4M1B_B Structural Determination of BA0150, a Polysaccharide Deacetylase from Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT3	2.69e-26	24	577	32	571	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
P23658	4.23e-20	24	582	4	543	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
P14090	2.25e-16	24	494	341	819	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
Q05156	2.71e-15	24	577	185	735	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
P50865	1.58e-14	606	825	49	243	Probable polysaccharide deacetylase PdaB OS=Bacillus subtilis (strain 168) OX=224308 GN=pdaB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999073	0.000195	0.000158	0.000159	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003448_00157.