CAZyme Information: MGYG000003448_00171

Basic Information

• Species: RC9 sp900767405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767405
• CAZyme ID: MGYG000003448_00171
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		41239.52	6.005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003448	1065599	MAG	Fiji	Oceania

• Gene Location: Start: 9940; End: 11031 Strand: -

Full Sequence      

MGECFYTLDPKIDFLLYKAIHELCDWRTEDGILRSPVPTGLDVSELPGQMLASIGPYGFW
NYYMNTGDKATLEYVYPVVKQYLSLYRQDGTGLTEFRKTGWNWGDWGFEKDMTLIYAGWH
ALALQSAQKMALELGYANDAAEYSRKYRSLKSGFNRCWKNGAYRTPDYTGKTDDRVQALA
VLSGIADRGKYDSILETLKAEEHASPYMEKYVMEALFRMGFGDYALERTERRFKEMVDNT
EFATLFEGWEIGSNDFGGGTTNHAWSGGTITVLASELCGIKPTKAGWEEFELRPAKATKE
HAYRISFPTVKGIVKSDWKVEGNRCDWTFTVPQGSKAKVYVPGNEGYTTFGPGEHTVNYK
LYK

Enzyme Prediction     

No EC number prediction in MGYG000003448_00171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	15	340	2.6e-59	0.6626984126984127

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.48e-14	25	268	74	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.63e-12	279	355	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	4.37e-06	60	163	109	215	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGH13557.1	7.72e-140	1	359	672	1026
AGH13541.1	4.88e-137	1	359	1010	1364
QQT79846.1	2.39e-124	1	361	377	730
QRP59702.1	2.39e-124	1	361	377	730
ASM67368.1	2.46e-124	1	361	378	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	7.37e-12	6	344	653	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.02e-11	6	344	653	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.88e-10	20	344	535	881	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	3.83e-08	134	361	924	1171	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003448_00171.