CAZyme Information: MGYG000003448_00707

Basic Information

• Species: RC9 sp900767405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900767405
• CAZyme ID: MGYG000003448_00707
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		36085.28	9.105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003448	1065599	MAG	Fiji	Oceania

• Gene Location: Start: 436; End: 1404 Strand: +

Full Sequence      

MKYIAAILASVVIAYVTSWNDSMPEATNLTCINYSFGHVNKKFNGVTIDNPRKLRKIVRL
KKKNPSLKVVLSIGGWGSGRFSEMVSDPVLRAKFARDCKRVVRRYRLDGIDIDWEYPGTS
VAKISSAPTDTENYTLMMRDIRAAIGPDKILSQATVASAKYINFADVEPYVDYTNVMTYD
MGDEHTHNSPLHRSAYTLGIGADEGLQMHMDAGIPASKIVMGMSFGARGAREFRRRWNPR
MPVDSLPQGYSFYRDMEAGGNPCIIDSTGVLVMAFEDTTSIRLKSEYALQQGFKGAMFWC
YEGDTPSGDLRRTIYHTFGLDK

Enzyme Prediction     

No EC number prediction in MGYG000003448_00707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	10	309	3.5e-58	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	8.04e-87	12	304	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	9.23e-63	11	299	1	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.91e-62	11	299	1	302	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	9.39e-55	12	299	1	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	2.54e-46	11	318	39	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL06948.1	3.31e-100	11	322	33	339
SCD19272.1	3.77e-100	11	317	36	340
QUT90190.1	1.51e-98	9	314	33	336
ALJ58703.1	5.98e-98	9	314	33	336
QDO71383.1	1.02e-96	11	315	34	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	2.43e-46	20	314	45	346	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	3.72e-46	20	314	64	365	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6INX_A	5.76e-40	11	304	6	329	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
1ITX_A	1.84e-36	41	321	95	418	ChainA, Glycosyl Hydrolase [Niallia circulans]
5GZU_A	8.24e-35	12	315	28	388	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.34e-34	41	321	127	450	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P36909	3.76e-26	9	312	239	602	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
Q13231	2.91e-25	60	308	83	367	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
P11797	5.01e-25	20	318	35	422	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
Q9WTV1	1.14e-24	13	310	23	361	Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004364	0.994709	0.000245	0.000217	0.000216	0.000230

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003448_00707.