CAZyme Information: MGYG000003449_01448

Basic Information

• Species: CAG-312 sp002405555
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp002405555
• CAZyme ID: MGYG000003449_01448
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	MGYG000003449_14|CGC7	59232.9	8.9174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003449	2395522	MAG	Fiji	Oceania

• Gene Location: Start: 436684; End: 438264 Strand: +

Full Sequence      

MLKKLIAAAALMPALAFASLDVKIDASKTHQKIDNFAAADAWSGQFVGQYFNDAQKGQVA
KWLFSQKIGADGNPEGIGLSMWRFNIGGGSLEQDGANIVPFQRRAESFLTKDGKAYDWGK
CAGQMYFVKKAKEYGVEKLLLFSNTPPVQYTRNGQGYGKPNDNKANIKPDCYGKFADYMA
DVAKKFGEWGYKVDYISPINEPQVNWDSNRQEGSPWYISEMKRVFVELDRALTERNLDTL
IYIGETAHPKYNYMNAAWDTPPSRWNKDPEAERPTYIIKNFFDKNSKAYVGNLKHMPKIV
SGHSYHAHLRNPDMVSVHKAVAAEAEKYGVEFQQSEWCLLPHYTAAQMDGFTKDWFSDNR
ADIQTALLMARIIHSDFVNTNSRAWGYWKGIEIKGDHALVGVYPTNGRLEDGGVARANKL
LWALGNYSLFIRPDFKRIELSGANDLDKTAGTAFVSPDGKRIVAVFVNSSFERDTAKVSL
PENFKNAKVRAFRTDANSDLANIWADESSREFTIAPRSITTLVFDR

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	21	523	2.9e-152	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	2.56e-103	22	388	4	353	O-Glycosyl hydrolase family 30.
COG5520	XynC	6.78e-12	19	526	33	430	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	7.27e-04	436	522	3	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84534.1	3.33e-122	5	525	8	529
QIK54438.1	4.44e-119	21	524	40	532
QIK59847.1	1.25e-118	21	524	40	532
VEH15029.1	8.55e-116	16	525	19	528
QUT89021.1	6.94e-115	22	525	42	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	2.18e-70	24	525	10	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	1.24e-13	22	496	25	422	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7NCX_AAA	4.02e-12	18	523	8	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7O0E_A	4.89e-12	18	523	1	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6KRL_A	1.87e-07	16	523	89	541	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	5.29e-12	18	523	25	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.998982	0.000191	0.000204	0.000191	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003449_01448.