CAZyme Information: MGYG000003451_00991

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter
• CAZyme ID: MGYG000003451_00991
• CAZy Family: GH153
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		38793.04	5.0961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003451	1832891	MAG	Fiji	Oceania

• Gene Location: Start: 440; End: 1447 Strand: -

Full Sequence      

MIYDENPVQRQKNTSLLFDRIQASGANVIYLQAFADPDGNGTADELYFPNRHLPMRSDFF
NYISWQLATRYKCEVYAWLPILGFDLKDRPVVQAVSPDKKVFYTRLTPFDANNRRIINEI
YEDLATHAPIMGIIFHDDGIIGDFEDVSPAGKAWLKSIGLPDDPEQIRKDPKLMHTFTRA
KSRALIDFTKELQATVEKWHPPVFTSRNMYAPVILTPQAEEWMAQNFDDFLTTYDYTGVE
AMPYMEGAADHADQWMQDLIDKVAQHPLGLRRTVFELQAKDWRPENLRPMPNEIMVKQMQ
QLLEHGAYNFGYYPDDPIIGHPDIRAIAPYFSARH

Enzyme Prediction     

No EC number prediction in MGYG000003451_00991.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH153	2	332	2.6e-130	0.9627507163323782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14883	GHL13	1.04e-150	2	313	7	325	Hypothetical glycosyl hydrolase family 13. GHL13 is a family of hypothetical glycoside hydrolases.
TIGR03938	deacetyl_PgaB	4.84e-149	2	334	281	619	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14582	pgaB	4.05e-127	2	332	324	663	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB.
PRK14581	hmsF	9.04e-111	2	333	324	665	outer membrane N-deacetylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDX33244.1	3.35e-216	1	335	335	669
ARQ46010.1	3.35e-216	1	335	335	669
ARQ78211.1	1.36e-215	1	335	377	711
ANA35062.1	5.42e-110	2	334	321	662
ATG22246.1	5.42e-110	2	334	321	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6AU1_A	6.63e-96	2	334	17	356	Structureof the PgaB (BpsB) glycoside hydrolase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],6AU1_B Structure of the PgaB (BpsB) glycoside hydrolase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
4P7L_A	2.83e-86	2	332	19	359	Structureof Escherichia coli PgaB C-terminal domain, P212121 crystal form [Escherichia coli K-12],4P7N_A Structure of Escherichia coli PgaB C-terminal domain in complex with glucosamine [Escherichia coli K-12],4P7O_A Structure of Escherichia coli PgaB C-terminal domain, P1 crystal form [Escherichia coli K-12],4P7O_B Structure of Escherichia coli PgaB C-terminal domain, P1 crystal form [Escherichia coli K-12],4P7Q_A Structure of Escherichia coli PgaB C-terminal domain in complex with N-acetylglucosamine [Escherichia coli K-12],4P7R_A Structure of Escherichia coli PgaB C-terminal domain in complex with a poly-beta-1,6-N-acetyl-D-glucosamine (PNAG) hexamer [Escherichia coli K-12]
4F9D_A	2.88e-80	2	323	287	618	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]
4F9J_A	3.35e-78	2	323	287	618	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75906	4.06e-82	2	332	324	664	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	4.06e-82	2	332	324	664	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003451_00991.