CAZyme Information: MGYG000003452_01194

Basic Information

• Species: Bifidobacterium ruminantium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium ruminantium
• CAZyme ID: MGYG000003452_01194
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526		56101.25	5.3884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003452	2217592	MAG	Fiji	Oceania

• Gene Location: Start: 7470; End: 9050 Strand: +

Full Sequence      

MARRWTPKRFVTLRRVRVMTCVAALTLTSALAFGIGARKSVALTVNGETKTVTTYAMSVD
RLLQEQGVKIKTHDLVESTSPTSMLKNHDVVTVQSAYQTTITINGQEVPFWTVASSAEQL
LDFFNQNETEAAKITVNINNVYNKLTGGLVINQKGPVTVIADGKSSVAPNGKLPAASILD
SKGITLSKEDRVNVEKDGGKTILRVRRVTHGEETRTKEVPFGTQTIVDPSLQPGEVTVRQ
EGENGEIQQTYAVTYVDGVKESETLSDEKTTKIAIDKVIAVGPAKSSSSDDSSDSDDSDN
SNNANGSGKTDDSSDSDTKNDSNAKGDSGKTDSSNKNNGSSDKSDSGKTDTDKNNGNGSG
NSQTNTDKNDSGKTDAGNGNGSNTSGSGNTKKDDSTPTPTPTPTPTPTPTPQPSDPSAGC
RLYHPSAAQAQAYAAGAAAQRGWTGQNWTDLVKLWNRESGWQWYAENAYSGAYGIPQSLP
GSQMAAFGARWKDDGAVQIDWGLSYIAQRYGTPSNAWKHSEETGWY

Enzyme Prediction     

No EC number prediction in MGYG000003452_01194.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	2.94e-41	16	282	15	282	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	9.41e-21	212	284	3	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	1.40e-07	41	77	1	37	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
NF035936	agg_sub_LPXTH	1.05e-05	310	394	52	136	serine-rich aggregation substance UasX. Members of this protein family are repetitive, serine-rich surface proteins of the Firmicutes, found primarily in the genus Leuconostoc. The variant form of sortase signal, LPXTH, is replaced by LPXTG in members from some lineages, such as Weissella oryzae, and therefore recognizable. Some members of this family have the KxYKxGKxW type signal peptide as seen in the glycoprotein adhesin GspB, a substrate of the accessory Sec system for secretion. WOSG25_050600 from Weissella oryzae SG25 is identified in a publication as an unnamed aggregation substance, a conclusion supported by the sorting signals and composition reported here. We assign the gene symbol uasX (unnamed aggregation substance X) based on our evaluation of the family.
NF035936	agg_sub_LPXTH	1.21e-05	307	395	24	113	serine-rich aggregation substance UasX. Members of this protein family are repetitive, serine-rich surface proteins of the Firmicutes, found primarily in the genus Leuconostoc. The variant form of sortase signal, LPXTH, is replaced by LPXTG in members from some lineages, such as Weissella oryzae, and therefore recognizable. Some members of this family have the KxYKxGKxW type signal peptide as seen in the glycoprotein adhesin GspB, a substrate of the accessory Sec system for secretion. WOSG25_050600 from Weissella oryzae SG25 is identified in a publication as an unnamed aggregation substance, a conclusion supported by the sorting signals and composition reported here. We assign the gene symbol uasX (unnamed aggregation substance X) based on our evaluation of the family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAF40395.1	1.31e-244	1	526	1	506
AVT46031.1	2.00e-244	1	526	1	508
AXR42445.1	2.59e-242	1	526	1	507
QHB63546.1	2.59e-242	1	526	1	507
AII77134.1	3.68e-242	1	526	1	507

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6N7	1.42e-13	38	268	42	273	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
P37546	3.02e-11	38	287	37	288	Putative cell wall shaping protein YabE OS=Bacillus subtilis (strain 168) OX=224308 GN=yabE PE=2 SV=2
A0R3E0	1.25e-06	27	282	13	269	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
Q8CQD9	3.22e-06	214	286	1223	1297	Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=SE_0175 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.691575	0.284967	0.021265	0.000473	0.000248	0.001477

TMHMM  Annotations     

start	end
13	35