CAZyme Information: MGYG000003454_01206

Basic Information

• Species: WG-1 sp900539665
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; WG-1; WG-1 sp900539665
• CAZyme ID: MGYG000003454_01206
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000003454_99|CGC2	38586.03	9.641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003454	2551473	MAG	Fiji	Oceania

• Gene Location: Start: 48195; End: 49283 Strand: -

Full Sequence      

MKKILVMAGGTGGHVFPGIAVAHELSAQQEFEVLWLGTAERMEARLVPQHGFKIAFIKVH
GIRRNGLLRKLGAPFMIARAIWEALGIIRKFKPDVVLGLGGYASGPGGIAARMLGIPLVL
HEQNAAPGFTNRVLSKIATRVLLGFPGALSGAKVSYVGNPVRSDVMALRQKLPHDFNGEN
LRISVVGGSLGAQVLNEIVPQAVAFAQKQGAKLEIMHQTGRGNSEAVKQVYADLGCTNVK
VSDFIDDMASLYENTHIIICRAGAGTVAEVTASCVPAIFVPLPSAVDDHQTKNAKVLADQ
KAAILLPQKELTAQVLSQKLCQFATDRTLLANISAEIAKMPCLDAAHEVANVCRDLAKGS
RE

Enzyme Prediction     

No EC number prediction in MGYG000003454_01206.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	183	340	8.6e-48	0.9554140127388535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.78e-161	1	359	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	9.77e-141	3	352	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	1.40e-124	2	353	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	3.26e-124	2	359	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.66e-44	183	349	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSX33993.1	4.30e-127	2	358	8	363
QUN06137.1	6.29e-125	2	361	8	366
QVK24786.1	7.80e-125	2	357	6	359
ACQ92154.1	8.73e-125	2	356	3	354
ART82889.1	1.71e-124	2	358	18	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	1.57e-100	2	358	7	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	4.15e-87	2	356	10	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	1.05e-84	3	359	4	357	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4LA25	1.75e-125	2	356	3	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=murG PE=3 SV=1
A8H984	1.61e-123	2	358	8	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=murG PE=3 SV=1
A1S2F9	5.49e-123	2	358	7	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=murG PE=3 SV=1
B0TQN7	6.49e-123	2	358	8	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=murG PE=3 SV=1
B8E698	1.35e-121	2	358	6	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella baltica (strain OS223) OX=407976 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003454_01206.