CAZyme Information: MGYG000003454_01802

Basic Information

• Species: WG-1 sp900539665
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; WG-1; WG-1 sp900539665
• CAZyme ID: MGYG000003454_01802
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		45448.08	9.4378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003454	2551473	MAG	Fiji	Oceania

• Gene Location: Start: 6745; End: 7965 Strand: -

Full Sequence      

MTSVAVSHLYAICVCEDSGDILAEGLVKRILEKDPSARFTGVYGPRIRAVIGKRGQILDM
SRFAVMGVAEVLKVLPRILMDRRKLKKALLAQKPDVFIGIDAPDFNLNVECFLKQHGILT
VHYVSPSVWAWREKRVFKVKEAADLVLSILPFEKAFYDRYGVACTYVGHRLAREIRGDVA
VRATRVGLGFSEGAYDCNQIIGIFPGSRHSEIKFLTPEFAQTAYNLKRKYPAMRFVCATP
TFEKAQMIAHLWNENAPNIPLTVWVGRSREVMASCNAIMVASGTAALEAMFLRKRMVVCY
IVNEITAAIGRRMLQIDSYSLPNILSGKKIVPELIQEDCNPANIENEIFKILNTENREQL
IEFARIHRLMNIDSDSLAAEAVLELVRKRAQATQAKVASVPNSSSN

Enzyme Prediction     

No EC number prediction in MGYG000003454_01802.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	11	368	3.2e-111	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.47e-148	11	390	5	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.98e-123	11	388	5	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
TIGR00215	lpxB	1.47e-95	16	385	14	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	1.29e-94	16	382	7	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	4.63e-41	7	354	226	571	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCV33357.1	1.04e-111	9	391	8	384
BCV50354.1	1.04e-111	9	391	8	384
BCV64623.1	1.04e-111	9	391	8	384
QWL07335.1	1.04e-111	9	391	8	384
BCV54706.1	1.04e-111	9	391	8	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.30e-87	11	387	10	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.60e-87	11	387	10	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1S4Q3	2.47e-107	9	386	8	379	Lipid-A-disaccharide synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=lpxB PE=3 SV=1
B8E7Q3	3.51e-104	9	396	8	387	Lipid-A-disaccharide synthase OS=Shewanella baltica (strain OS223) OX=407976 GN=lpxB PE=3 SV=1
A3QG90	1.45e-103	9	389	8	382	Lipid-A-disaccharide synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=lpxB PE=3 SV=1
Q8EGG2	6.38e-103	9	386	8	379	Lipid-A-disaccharide synthase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=lpxB PE=3 SV=1
B1KNT0	1.75e-102	10	390	9	383	Lipid-A-disaccharide synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003454_01802.