CAZyme Information: MGYG000003456_01786

Basic Information

• Species: UMGS1865 sp900547725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1865; UMGS1865 sp900547725
• CAZyme ID: MGYG000003456_01786
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		60544.98	6.0855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003456	2491093	MAG	Fiji	Oceania

• Gene Location: Start: 2854; End: 4473 Strand: -

Full Sequence      

MGKKTTKHERGPAVLPLTPALPKKRTTRKPAAEKPAETETVTTTTPEAVSAMAENAVGTE
TAKKKILFVGAEVMPFAATGGLGDVLGSLPAALAKTGRVDVRVVLPLYGSIAQSWRSQMR
EEYVTSVRLAWREQYCGIYSLVRDGVTYYFIDNEYYFRRPALYGYFDDGERYAFFCMAVM
EMMNRLNYYPDILHAHDWQAALSVVYLNCLYRNRPWYGTMRTVFTIHNIEYQGQYDFAIL
GDVFALGENEHALMEYNGCINLMKAAIECADRVTTVSPRYAWEIRTPEYAHGLDAALNRN
AGKLSGILNGIDYDFYNPATDPCIAERYSVQNMAGKTADKLALQRETGLPERADVPMLAV
VSRLAAHKGLDLVSGCIYELVGGHDLQLVILGKGESGFEDFFRELQARFPDKVRALITYD
RDLSKRIYAAADIFLMPSRSEPCGLSQMIASRYGAIPVVRETGGLYDSIKPYWVEGDTLH
GNGFTFANYSAQELRERTEAALGVWYNKPERDRLVERVMTTDFSWNASAEQYLALYEGI

Enzyme Prediction     

No EC number prediction in MGYG000003456_01786.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	65	537	1.8e-172	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	65	538	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	65	539	2	463	glycogen synthase GlgA.
COG0297	GlgA	0.0	65	539	2	478	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	65	539	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	6.99e-116	65	536	5	476	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60006.1	1.21e-159	65	539	2	472
QNK41915.1	2.78e-158	65	539	2	471
AIQ41840.1	4.36e-158	65	539	2	472
AIQ30256.1	6.17e-158	65	539	2	472
AGX05960.1	8.74e-158	65	539	2	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	6.34e-86	64	537	125	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	3.81e-85	65	536	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.32e-84	65	536	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.02e-83	65	536	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	2.64e-83	66	536	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IS20	8.99e-150	65	537	2	472	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	3.61e-149	65	537	2	472	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
Q1WSN1	3.95e-146	65	536	2	472	Glycogen synthase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=glgA PE=3 SV=1
B7GK04	2.92e-145	65	537	2	472	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
P39125	4.14e-145	65	539	2	475	Glycogen synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999404	0.000506	0.000052	0.000004	0.000002	0.000039

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003456_01786.