CAZyme Information: MGYG000003458_00015

Basic Information

• Species: CAG-127 sp900767585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900767585
• CAZyme ID: MGYG000003458_00015
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000003458_1|CGC1	73890.79	5.0011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003458	2703450	MAG	Fiji	Oceania

• Gene Location: Start: 17743; End: 19671 Strand: +

Full Sequence      

MKFRLPDFDSGKIKKGIEHIRTTTLPEAFSKARSMVTGTDLAYDRFFRDCLEADEETLAL
QRTHVFPYAPLVSVIVPVYMTPELSLRAMIESVQHQTYENWELCLVDGSLVKGDLPVLDA
RRMNDEEPTVLEKVYSLETERIIRQYMEGDNRIHYRKMEENQGISGNTNQALSMAHGVYA
AFLDHDDVLTENALYEVVASLQDTQYDLLYSDEDRMSENGSHYMEPRFKPDFDIDLLRSY
NYIAHLLVVRRSLLLEVGGFRGQYDGAQDYDMLFLCAEKKIEICHIANVLYHKRIHEGDS
AEREIKHARENQAGKEALEAHVEREHLLATVECAAKRSVYRVRYDTPGNPLVSIIVHGHT
DRTCMARLLEPFYEKSRYSNFEIIVVDIDHTDAELQRYYQQMQSRRKNLIVIAVPEGKSV
AEYCNIGSTGAHGAYLLFLDAALELRTPAAIGEMLGICMRGDVGIVTGVVYDDADEIYYA
GLEFAGKYENNVQTWQRETERQVKLEPENNLYRYPYRGIRNPDASVKLWDVYPDETGARR
YFGMNREFEIALPVCMLVKKGVFAQTGGFSERFWSNCAILDFCLRVREHGFLIVSAAQAL
WNFPALPDTVRQMREQETLDAQKLQAEQDLFEILWPQISSLR

Enzyme Prediction     

No EC number prediction in MGYG000003458_00015.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	138	240	1.8e-16	0.6529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.02e-77	70	295	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	2.31e-21	73	208	1	110	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.51e-16	74	211	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	2.20e-13	70	299	3	202	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06433	GT_2_WfgS_like	1.45e-11	73	300	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL99672.1	3.73e-303	1	642	1	642
QWT52369.1	6.12e-302	1	642	1	642
CBL21583.1	4.87e-109	13	594	24	546
QCU01342.1	5.30e-108	13	594	24	546
CBL08067.1	1.14e-102	12	601	227	772

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.46e-54	70	591	366	833	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	8.52e-48	70	598	319	787	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	9.17e-13	70	306	8	224	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
O32268	6.00e-08	68	221	4	131	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
A0A0H2UR96	9.37e-07	71	283	4	207	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003458_00015.