CAZyme Information: MGYG000003458_00076

Basic Information

• Species: CAG-127 sp900767585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900767585
• CAZyme ID: MGYG000003458_00076
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000003458_6|CGC1	36768.4	4.4552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003458	2703450	MAG	Fiji	Oceania

• Gene Location: Start: 6379; End: 7368 Strand: -

Full Sequence      

MNEKKREYEINWPHVILVGAIAVVLVLIGVVIGVNIGARNKSKPVPVTGSGYTWSLQPGA
EAQMIYANFWQFAKASYVLVGDIPNCEFYKIVKEVPRNDFQTDNFSIDEGDESTRMYYHA
DDGSKLSELAVDVSSYQSALDWEALKQAGVTIAFIRAGYRGYGTEGKLVTDEMFQTHIEA
AKAAGMKVGIYFYSQALNYDEGVAEAQYALNLTKDYALDMPIAIDTEEVYADGARTADLT
NDARTDGVVGFCETVKNAGYTPMIYSNRNWFVQKLDMTRLGSYKLWLAHYANQPDFPYLY
SGWQYTGTGKIAGIEQDLDLNVWMEGSVY

Enzyme Prediction     

No EC number prediction in MGYG000003458_00076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	131	314	2e-47	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.42e-75	131	324	4	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	7.60e-41	131	323	3	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	3.95e-36	131	321	3	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	7.80e-36	131	314	1	180	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	5.28e-27	129	322	1	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT52701.1	4.52e-202	1	329	1	328
QNL99368.1	9.05e-200	3	329	4	329
CBK83179.1	1.63e-79	6	325	7	321
QYX28904.1	2.25e-63	90	322	55	283
QRO38911.1	4.35e-63	90	325	55	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WWC_A	2.55e-13	123	323	264	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	1.23e-12	131	321	8	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
6ZMV_A	2.17e-07	132	273	6	142	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P34020	3.13e-20	131	326	4	183	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P25310	1.67e-11	131	321	85	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
Q8T2I5	1.15e-06	178	327	66	219	Probable GH family 25 lysozyme 3 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276439 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999775	0.000206	0.000002	0.000001	0.000001	0.000053

TMHMM  Annotations     

start	end
12	34