CAZyme Information: MGYG000003458_00468

Basic Information

• Species: CAG-127 sp900767585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900767585
• CAZyme ID: MGYG000003458_00468
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1012	MGYG000003458_28|CGC1	116767.04	4.7463

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003458	2703450	MAG	Fiji	Oceania

• Gene Location: Start: 8103; End: 11141 Strand: +

Full Sequence      

MIVPRYYEDLNLLHEHTMPPRAYYIPASRRMEDLVEHREASDRVQMLNGMWKFRYFESIY
DVRDAFYESGYDTSDFDEIPVPGVWQMAGYDTHQYTNFRYPFPFDPPYVPQDIPCGAYVH
TFSYAKDEKAPKVYLNFEGVDSCFYVWVNGTYTGYSQVSHATSEFDVTDVIEEGENTIAV
LVLKWCDGSYLEDQDKFRMSGIFRDVYLLKRPEKAVQDYRITTEITETWAKITLDISYYQ
ETSVTVSVEDAAGTVAAQAEINKAGTVTLEIATPELWNTEHPYLYTLILQSADETIVDAI
ALRTVAIQERVLYFNGQAIKLRGVNRHDSDPVTGFTVDVAKIKKDLVLMKEHNFNAIRSS
HYPNAPYFYQMCDRYGFLVCDEADIEAHGPFMLYRKEDTDYNRFKKWNEKIADDPAWEQA
ILDRVKRMVARDKNRFCIIFWSMGNESAYGCNFEKALAWTKKYDPSRITQYESARYRNYD
VTYDYSNLDLYSRMYPALSEIEEYLEKDGSKPFLLVEYCHSMGNGPGDLEDYFQMIQKDA
RMCGGFVWEWCDHAVAHGLAENGKTKYYYGGDHGETIHDGNFCMDGLVYPDRTPHTGLLE
YKNVYRPVRVVSYDEKTGRLVLHNYMDFDDISDYTDILYEVTVDGLCVQKGVLDEVSIAP
HSDGVMTLKLDIPQSGKVYLKLRYQLKKELPLLPAKHELGFDEVLLANADGRNQTAVKWL
AEAEEKNEISVSETDTEITLKASDFAYAISKRTGLFTKLQYAGRDYLNHPMELNIWRAPT
DNDMYIRAKWENAHFHEAYTRAYKVETIQNRYGVIVMSHVGVVAPTVQKILDVELVWKVE
SSGRITASMEVSKDEEFPELPRFGVRVFFDKNLSEASYYGMGPQESYRDKHRAASHGLYR
SAVKDLHEDYIMPQENGSHFDCDYVELHNGRYGIAAVSETPFSFQASNYTQEMLTQAKHN
YELEESDSTVLCIDYALNGIGSNSCGPEVLAAYRFDEKEFQFGFTLVPYVKG

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	34	895	9.5e-212	0.9720744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	10	1006	25	1024	beta-galactosidase.
PRK10340	ebgA	0.0	7	1012	4	1003	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.44e-131	44	894	12	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	3.44e-94	305	608	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02929	Bgal_small_N	2.49e-88	741	1006	1	230	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL99224.1	0.0	1	1012	1	1012
QWT52792.1	0.0	1	1012	1	1012
QNM02293.1	0.0	1	1012	1	1012
ACR72837.1	0.0	1	1012	8	1020
CBL21217.1	0.0	1	1012	1	1012

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.84e-176	3	1006	1	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	2.51e-176	4	1006	1	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6ETZ_A	3.03e-152	47	1006	39	985	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
3BGA_A	3.67e-152	39	1012	43	1004	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SEB_A	5.14e-152	47	1006	60	1006	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	1.61e-302	1	1007	1	998	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	8.38e-246	1	1006	1	991	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
P06864	4.46e-181	7	1008	4	999	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q56307	1.01e-175	3	1006	1	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P81650	4.64e-175	29	1006	34	1033	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003458_00468.