CAZyme Information: MGYG000003461_01115

Basic Information

• Species: Prevotella sp900553595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553595
• CAZyme ID: MGYG000003461_01115
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		45177.97	8.9983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003461	2310521	MAG	Fiji	Oceania

• Gene Location: Start: 3437; End: 4636 Strand: -

Full Sequence      

MFRYKKYTSLFVILLAMLGCTPNKHQELTPWGESLYGDSTTCAAAFSINDILASGEMIML
TLNGPNTYFVYHGKNMGTQFLLCEKFAQKLGVALRVDVCKDTLEMIAKLRAGEGDVIAVP
LPKKAIKGIRYCDFESNPQSDAWAVNSDCAELADSLNHWFTPALLASIKQEERVLFSTGG
VHRRTYAPMLHADRGIISSYDHLFMRYAPLARCDWQLMAAQCYQESTFDPQAYSWAGAKG
LMQIMPSTAAELGLAQADIYEPEPNIHAAARYIAKLNGLFQDIRNPQQRQLFVLASYNGG
HFHIRDAMALAKKNGRNPHQWSDVAEYVLKLETPQFYRDPIVKYGYMRGSETVNYVSRIY
DRWMKYRGVARGHIPNTGNATTPDMYMPQKAQKKRKFKL

Enzyme Prediction     

No EC number prediction in MGYG000003461_01115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	214	362	8.2e-28	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.12e-75	204	367	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.89e-47	6	359	7	443	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.24e-44	51	382	19	443	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	2.09e-22	214	319	11	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.12e-21	217	363	3	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	2.65e-157	12	399	40	433
EFC70077.2	3.00e-156	6	397	4	389
ALO48082.1	4.74e-155	11	397	8	389
AGB28026.1	5.04e-155	9	399	30	413
BCS86517.1	4.03e-151	16	399	6	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA2_A	6.06e-23	200	384	300	491	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA4_B	6.09e-23	200	384	252	443	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	6.09e-23	200	384	252	443	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	8.18e-23	200	384	300	491	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	8.18e-23	200	384	300	491	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	7.12e-35	47	359	33	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A0L862	3.75e-28	197	359	282	440	Membrane-bound lytic murein transglycosylase F OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=mltF PE=3 SV=2
B0KRE9	4.42e-26	81	388	162	484	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mltF PE=3 SV=1
A5VZC8	8.18e-26	197	388	286	484	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=mltF PE=3 SV=1
Q88P17	1.11e-25	197	388	286	484	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000004	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003461_01115.