CAZyme Information: MGYG000003461_01277

Basic Information

• Species: Prevotella sp900553595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553595
• CAZyme ID: MGYG000003461_01277
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214	MGYG000003461_382|CGC1	23606.13	8.2758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003461	2310521	MAG	Fiji	Oceania

• Gene Location: Start: 3107; End: 3751 Strand: -

Full Sequence      

MRQFKASYTETFSGFATRHQLSQKPIIALLAGSRRQEITDNLPAMIQAASRFHDYQLVLA
GAPGIDAGQYSRLIEGTGVSLVHNDTYALLSHATLAVVTSGTATLETAIFGVPQVVCYKT
PLPRFIAFCRRHVLKVKYISLVNLIVDEEVVTELVADTFSAENIARCLADIMPGETGRQR
MLDGYRRVHDLLGDSNAPENAARIMTDLLRRGKQ

Enzyme Prediction     

No EC number prediction in MGYG000003461_01277.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	15	192	1.3e-45	0.5056497175141242

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	1.77e-39	16	211	177	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	9.05e-39	16	213	175	379	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.90e-23	24	204	185	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	8.97e-17	18	164	161	309	lipid-A-disaccharide synthase.
PRK01021	lpxB	7.02e-08	3	195	398	592	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR11189.1	1.20e-75	4	211	171	383
ATV28799.1	8.32e-75	4	211	171	378
ATV37966.1	1.18e-74	4	211	171	378
ATV52763.1	4.71e-74	4	211	171	378
APW34950.1	6.66e-74	4	211	171	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.04e-07	27	208	194	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.04e-07	27	208	194	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C1F718	6.48e-22	9	211	173	392	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q1D393	1.01e-20	10	213	174	382	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	7.02e-20	15	209	184	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q02AZ6	1.28e-19	15	209	176	373	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q7V5X6	6.19e-18	18	210	185	391	Lipid-A-disaccharide synthase OS=Prochlorococcus marinus (strain MIT 9313) OX=74547 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003461_01277.