CAZyme Information: MGYG000003461_01385

Basic Information

• Species: Prevotella sp900553595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553595
• CAZyme ID: MGYG000003461_01385
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621		70181.03	7.1169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003461	2310521	MAG	Fiji	Oceania

• Gene Location: Start: 703; End: 2568 Strand: -

Full Sequence      

MQAQHHWAQIKSYINLTHNFYHMKKLILTALVLMAAIAGTAQTHIPPIFGSDSANFRHDI
MTRSFITPKRVVWTNSSDAVQNAELLLKKNTGQPDIFDTGMCRLVSHKGGDASIILDFGH
ELHGGLKLVISSCTPTETPLLRVRFGESVSETCAELNTGKSIAETGSKAEVNLKTNTATN
DHAVRDMQIKVPFYGQIEVGNTGYRFVRIDLLTPGQTINLKEATAILRYRDIAYTGSFKS
SDKRLNDIWMTGAYTVHLNMQEYIWDGVKRDRLVWMGDMHPETHTISTVFGDNDIFYSTL
DLVCKQYPVTRWINDMSAYSLWYLIIQYDWYMKFGHKDFLERHRDYILSLVDKIDRCIDD
NGNDDMGWHFLDWPSTPNEKGVEAGFHALTVWAMNDAAKLCRILGDEGKARKSEGVVARL
KRKTTDPNNLKQAAALMAIAGLMTPSQACKDYVAVDGARGFSTFYGYYMLEALAMDGRYD
EALKIISDFWGGMIDMGATTFWEDFNLDWTKNAFRIDELPVEGKQDIHGDFGAYCYPGYR
HSLCHGWASGPTAWLSRHVLGVEILEPGCRRVRITPHLGHLQWAEGSYPTPYGVITVRHE
RMNDGTIRSDIKAPKGVKVVK

Enzyme Prediction     

No EC number prediction in MGYG000003461_01385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	111	619	8.1e-101	0.9801587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.54e-19	235	559	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.09e-07	561	618	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69834.1	3.07e-274	26	621	7	590
QUT42018.1	1.24e-273	26	621	7	590
BCA48698.1	8.27e-272	26	621	7	590
QUT59644.1	3.44e-266	41	620	20	588
QDO68956.1	1.67e-263	23	620	1	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.14e-44	111	616	191	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	3.01e-22	203	619	504	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	9.47e-14	113	557	94	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.291520	0.664190	0.043095	0.000380	0.000348	0.000455

TMHMM  Annotations     

start	end
26	48