CAZyme Information: MGYG000003465_00682

Basic Information

• Species: CAG-841 sp900544285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-841; CAG-841 sp900544285
• CAZyme ID: MGYG000003465_00682
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000003465_15|CGC1	53083.5	5.2182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003465	1993474	MAG	Fiji	Oceania

• Gene Location: Start: 160758; End: 162188 Strand: -

Full Sequence      

MKSVLFAGSEALPFAATGGLGDVMGSLPAAIKAAHPEADVRAVMPLYSKVGKQYRDEMTF
EKSITVTLAWRRLYCGIFSLERGGVKWYFIDNEYYFLRDRIYGEFDDAERFAFFSVAVLE
LMGAEGFFPEVLHCNDWQTALSVILLKTRYNSYYGYSGVKAVYTIHNIDYQGEYGMEILG
DVFSLSDAESGIVEYNGNINLTKGAIVCADFVTTVSPHYAKEIQDDYFAHGLGNITRMYS
GKIDGIINGIDVAANDPKTDPDIPKNYSWRSLTGKAVCKEELQKMTGLNVDPEVPIVAMI
SRLAEHKGFDIVRFGIDGIMQNNNIQFVLLGTGDPDTENFFRGFASRYPGRAAVMIKYDR
KLSKQIYAGADIFLMPSKSEACGLAQMIASRYGTVPVVHEVGGLYDTIKPYGAGGNGFTF
AAYNADDMGNVIYQATELYKDKEAWKKLVRKIMRIDFSWNVSAEKYVGLYENVINQ

Enzyme Prediction     

No EC number prediction in MGYG000003465_00682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	4	471	3.2e-163	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	4	472	2	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	476	1	466	glycogen synthase GlgA.
TIGR02095	glgA	0.0	1	473	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	5.54e-170	1	475	1	480	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	6.58e-104	3	476	5	482	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1243454.1	3.27e-166	4	476	3	474
ASB40510.1	3.75e-165	4	474	3	473
QQR29794.1	3.75e-165	4	474	3	473
ANU52824.1	3.75e-165	4	474	3	473
QNO18264.1	2.73e-162	4	476	3	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	9.72e-77	4	470	3	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.32e-76	4	470	3	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.55e-75	4	470	3	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	8.99e-75	4	476	12	500	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	5.64e-74	2	471	125	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1WSN1	3.49e-141	4	474	3	476	Glycogen synthase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=glgA PE=3 SV=1
A0PY73	1.55e-140	3	476	2	478	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
A6TSC8	3.10e-139	4	473	3	474	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
Q5FL65	1.18e-136	4	474	3	475	Glycogen synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=glgA PE=3 SV=1
B7HBC4	9.49e-136	3	474	2	475	Glycogen synthase OS=Bacillus cereus (strain B4264) OX=405532 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997752	0.002262	0.000013	0.000002	0.000002	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003465_00682.