CAZyme Information: MGYG000003465_00717

Basic Information

• Species: CAG-841 sp900544285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-841; CAG-841 sp900544285
• CAZyme ID: MGYG000003465_00717
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000003465_15|CGC2	42757.69	5.0931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003465	1993474	MAG	Fiji	Oceania

• Gene Location: Start: 202599; End: 203729 Strand: -

Full Sequence      

MTDKRRNLFLLVCELLALFLVFAFIMTCGSSSYMKELFEKTEYPRNYVEFVRKYSYKYGV
DENLIFAIIKAESGFDKDAESKAGAIGLMQIMPLTYEGDLKVPLGFDKSGKEIHKNVYTA
LRDPQTNIICGIYYFSRLQERFGDDATALAAYNAGQGNVTKWISNPLYTALSGKLDPDKI
PYKETRKYVRRVLSYYERYKEIYGENKAGESDSIPREQALEYAKKYGAQFKVDYNFIMAV
IETESSFRYMVVSSSGAMGLMQMKADTYRVDVAANLGLSQGADELFDPEFSIMCGAYYLH
WLDYRVDGINTIAAAYHGGIGTVRGWLADESISPGGILDPEKIPDAATKRYVEKIRSFYE
KSLELDGPDETYKFDF

Enzyme Prediction     

No EC number prediction in MGYG000003465_00717.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	63	200	1.7e-29	0.8
GH23	235	363	6.7e-22	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.14e-56	44	198	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.63e-48	43	202	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	8.07e-37	216	361	5	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	7.72e-36	62	197	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.70e-32	1	208	94	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO16977.1	1.19e-34	6	203	19	208
ACL76418.1	6.66e-34	23	207	20	195
QIB28150.1	1.30e-33	2	203	5	187
AHF06569.1	2.28e-33	18	204	15	190
AXU49364.1	3.68e-33	24	204	12	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	2.06e-16	43	205	449	604	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	2.75e-16	43	205	449	604	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	2.08e-15	59	195	461	588	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.15e-15	59	195	490	617	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	4.98e-15	59	195	461	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.85e-18	51	196	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	9.34e-17	43	196	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	9.34e-17	43	196	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P39434	1.51e-16	43	213	476	639	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	1.16e-15	43	205	476	631	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.856922	0.120329	0.008494	0.000793	0.000593	0.012881

TMHMM  Annotations     

start	end
7	29