CAZyme Information: MGYG000003466_00822

Basic Information

• Species: Treponema_D sp900767955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900767955
• CAZyme ID: MGYG000003466_00822
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	MGYG000003466_30|CGC1	86782.34	7.0149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003466	2580548	MAG	Fiji	Oceania

• Gene Location: Start: 20955; End: 23246 Strand: +

Full Sequence      

MKKIIFSVSLLLTSFMLFAYEFKTDSFEITKNKVVSLTDKNSAYVEGNNLVSTYEGTTYQ
RKVVYNNGPVVKTNDSIVDYLTQMAMEETVANITKDGVFSAGANWPTAWTRDMSYAIDLS
LAFLFPQTVEKSLASRVEDNIILQDTGSGGSYPVSTDRVVWGLAAYDYALVKQSDEYFRW
IYEVLTKTIEYDYNVTFDKKTGLFRGESSFLDWREQTYPRWMDNVYIADSYALGTNMVYY
AALKRISYLANRFSEVDSYNLWNKRAEQLKENIVKNLWLNEEKYFGAYLISHVYPFLYKG
YETLGESLAIMEEIVPSQEWNNIITAVKPGKWGMSVVAPQLGNVPSYHNDAVWPFVQGYR
GLAAKKAKNAYFCEYEFASMIYCATLFRTFKENYVASTYSPKTQTNSDRQLWSDAGWLSY
IYKILFGIDFVDNGIKISPFVFDSFKNGISLKNFTWNGNKMNISIQGTGDKVVSYTVNGK
SVPSDYVIPYENNKVYDIKITLEKSQEFIDSYKIADIKYKFSAEDVTPMVPIVSSMFEKN
NLSLKWRQKNNNGFDVFKNGKYLKTITDRNIVVPAKNNVDLYTVISSQNNLPCLPGTPVR
TDNKKNTTFYEAENAVISGGKISQAENPETFNVSADLIATIPNGTGFVEKWGSSEGEEIK
FSCNAKKSGNYLVDFRFKNGHGPINTGEKCAVAAIYVNDELIRRVAMPQQGNWVSWNFTV
PVIVNLPKGKNTISLKIDEYCYTQHHALNHVSVDLMRLSKVSD

Enzyme Prediction     

No EC number prediction in MGYG000003466_00822.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	2.44e-19	610	739	3	112	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04082	CBM35_pectate_lyase-like	4.40e-10	608	735	1	108	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam06202	GDE_C	9.40e-10	100	359	22	306	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	8.03e-07	176	453	350	626	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04086	CBM35_mannanase-like	6.95e-06	610	736	3	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU30083.1	3.09e-116	69	763	221	891
AKD02081.1	1.98e-115	69	761	232	898
BCI63186.1	1.68e-112	24	760	177	897
QNL49078.1	1.13e-111	58	738	201	856
ARS34527.1	2.51e-110	69	761	233	899

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X7O_A	5.15e-06	609	738	835	949	Crystalstructure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7O_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7P_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7P_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7Q_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7Q_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7R_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7R_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7S_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K],5X7S_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002835	0.988506	0.007945	0.000235	0.000224	0.000235

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003466_00822.