CAZyme Information: MGYG000003466_02021

Basic Information

• Species: Treponema_D sp900767955
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900767955
• CAZyme ID: MGYG000003466_02021
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
924		100468.7	4.9003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003466	2580548	MAG	Fiji	Oceania

• Gene Location: Start: 4841; End: 7615 Strand: +

Full Sequence      

MKKIINFIFAISLVAGLFIGCNNSVTLGEETLDMSGSRAVVPEAERTSTVKIYVFNLPKD
KPMYMTIPWNIWAWREEGAADTNYNAKGWPGGDYTLSADSNLEAVSGEFSVDPTYPLGIL
FNHPGQGGQGATQTKDIIIPKEKIQNGAELYFVYGETAYYTSAKECLGLRYAELAAVDGK
SLTAQIVGHKVANVTKDSVIVKDNAGNALTVSAVTYDGSTAKITLADGGLTKLPYTVEYD
GVTKEAGVLASMIDEIGWTYDGNDLGVTFEGTKATFKMWAPLASKVSLLLYDDVADVGNF
KATTVAANACGSTEETELKGTPAVDPIVMTKDNATGVWSYELADYSAYKYYKYEIVNKGT
TYYVCDIHAKAASPDSIAAQLVDINVGTDYGTKQNYVNPFGNSGETQKSYADAVIYEMHI
RDWAKAFDGEGKFIELAESEKFIAHLKEMGITHVQVVPMFDYAQVNSDKNYNWGYNPYHY
NVPEGRYVKDMKDGMDAVKQLRQFIKALHDAGIAINMDVVYNHTAGIGGGSLYDSTVPEY
FYRLVNGSYNNGSGCGNETASNHKMFKKYMIESLKHWMLDYHINGFRFDLMAIHEEDVMK
EVYDELYKIDPNVMVYGEPWDGGGTKADPATTAAVKSDTNPMGAGAFDDDFRNAIKGGEF
GGFGHGQVQGTFEDAKIVAGLQGSNCTRNETGNSALSIHYVECHDNYTLFDKLAMSYLNK
TTFSGDLFAEIGADGLKAVKAQNKLAAAYVFLAQGTPFINGGQEFLRTKQGNHNSYSAEK
PWTNDAGALNIDVCNGIDLSFATKYADVVATYKGLIALRKDFSAFRYAKTAKAETVSEGV
TKYDVTADDGNFTVLFNATNKPVSVTAVDGKVVNVNGGVKLSGSYFGLGFNDASASASAK
KYTIADTETTVSSVPAKSFVILKK

Enzyme Prediction     

No EC number prediction in MGYG000003466_02021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	444	764	8.6e-90	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11341	AmyAc_Pullulanase_LD-like	8.26e-158	412	819	2	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
TIGR02104	pulA_typeI	1.39e-153	258	866	6	585	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
COG1523	PulA	3.53e-95	274	827	69	593	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02102	pullulan_Gpos	3.72e-81	69	850	128	920	pullulanase, extracellular, Gram-positive. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. In contrast, a glycogen debranching enzyme such GlgX, homologous to this family, can release glucose at alpha,1-6 linkages from glycogen first subjected to limit degradation by phosphorylase. Characterized members of this family include a surface-located pullulanase from Streptococcus pneumoniae () and an extracellular bifunctional amylase/pullulanase with C-terminal pullulanase activity (.
PLN02877	PLN02877	6.04e-63	236	778	186	788	alpha-amylase/limit dextrinase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSI02745.1	1.13e-221	71	924	63	878
QQA01551.1	1.16e-217	245	924	271	897
AEB13374.1	6.15e-195	250	865	12	577
QJS18678.1	7.43e-111	32	866	135	939
SNX53642.1	7.21e-109	260	862	42	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAN_A	7.44e-91	181	826	230	831	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]
7LSA_A	1.42e-83	258	874	57	678	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	1.88e-82	258	874	57	678	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	1.95e-82	258	874	57	678	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	1.99e-82	258	874	57	678	ChainA, Pullulanase [Ruminococcus bromii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	9.01e-89	240	826	203	752	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	1.25e-68	260	841	102	635	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
Q9F930	4.28e-59	70	861	268	1092	Pullulanase A OS=Streptococcus pneumoniae OX=1313 GN=spuA PE=1 SV=1
A0A0H2ZL64	5.42e-59	70	861	246	1070	Pullulanase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=spuA PE=3 SV=1
A0A0H2UNG0	5.65e-59	70	861	261	1085	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27