CAZyme Information: MGYG000003467_00150

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003467_00150
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		33460.3	7.052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003467	1904394	MAG	Fiji	Oceania

• Gene Location: Start: 11; End: 892 Strand: +

Full Sequence      

MERYGIPASITMAQGILESDSGNSNLARRSNNHFGIKCKKDWKGAKVYHTDDAPNECFRK
YDSVEDSYEDHAEFLDNSPRYDSLFAYPSNDYRSWARGLKAAGYATAPDYAQRLIKIIED
NKLFLLDNENGALLYASRFKSNENVAETFAENSSVNVPTTTEGRIDPNDYRVVERTYNGY
SVYSNNLSHFVIARNGDKFADIASTFAITERTLRKYNEINPKSTADPIEGEMIYIERKQT
KWMGDEQYHTVKPGETLLSLSQEYGIRMKKLAALNRLKPNTQLQIGQQVKLHK

Enzyme Prediction     

No EC number prediction in MGYG000003467_00150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	2	123	8.5e-38	0.921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.23e-35	2	137	59	198	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	4.25e-33	1	127	175	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	1.08e-27	1	123	8	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	2.99e-22	2	118	168	294	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	6.91e-22	1	119	23	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64601.1	1.69e-116	1	291	44	333
BBL04344.1	2.59e-115	1	291	41	331
BBL13853.1	5.20e-115	1	291	41	331
BBL07002.1	2.59e-113	1	291	45	333
BBL09489.1	3.80e-113	1	291	44	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.55e-15	2	123	17	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.10e-15	2	123	18	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.15e-14	2	123	18	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	1.62e-09	2	122	19	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.10e-09	2	122	19	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.33e-15	2	133	64	204	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.78e-13	5	117	179	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	2.18e-13	5	117	180	302	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	6.85e-10	2	117	255	381	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	1.77e-08	2	122	165	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003467_00150.