CAZyme Information: MGYG000003467_00497

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003467_00497
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		33703.29	6.0907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003467	1904394	MAG	Fiji	Oceania

• Gene Location: Start: 2768; End: 3664 Strand: -

Full Sequence      

MKKTILAIALALIAFTSSAQDPDQIRQWMRNMSRVEEKTIHSEILNADRNYTVYLPAGYA
NNTDKQYPVLYLLHGMNGTNKDWAGRGHLQDVMDQLRAAGEVCDMIVISPNAGGNIGEGV
WNGYFDMEGWAYERFFFEEFLPAVEKEYRIKGDKGSRAIAGLSMGGGGSTSYAQRHANMF
CACYAMSALMHLDAPQAQAPRDEKDKMWHLTKAVNKLSCVDYVANADDKTKEALRTVAWY
VDCGDDDFLFECNMNLVLAMRKAGIPYQLRVRDGGHTWEYWHSALYDALPFVSRIFEK

Enzyme Prediction     

No EC number prediction in MGYG000003467_00497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	293	9.9e-58	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	2.00e-27	42	291	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.64e-26	47	298	33	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	2.03e-25	28	289	59	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4947	COG4947	3.77e-06	131	285	89	223	Esterase/lipase superfamily enzyme [General function prediction only].
COG2819	YbbA	6.31e-06	49	166	23	148	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT65236.1	5.25e-30	41	285	154	389
QQA30430.1	7.28e-30	41	285	154	389
QUT61959.1	7.28e-30	41	285	154	389
QMI79541.1	7.28e-30	41	285	154	389
AEV69022.1	9.15e-30	1	294	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	2.19e-115	33	298	10	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	2.04e-27	42	294	139	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	1.98e-21	10	294	1	259	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	5.23e-21	10	294	1	259	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	3.33e-18	42	166	146	275	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.31e-19	10	294	20	278	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	3.99e-19	49	294	445	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	2.03e-13	31	285	496	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000298	0.998947	0.000202	0.000174	0.000177	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003467_00497.