CAZyme Information: MGYG000003467_01586

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003467_01586
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42481.36	6.7538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003467	1904394	MAG	Fiji	Oceania

• Gene Location: Start: 12953; End: 14080 Strand: +

Full Sequence      

MKYYIIAGEPSGDLHGSNLMKGIRKSDPEAQFRFWGGDMMASVGGKDNLVKHYREMSFFG
FVQVAMNIRTILGQMGDCCRDIKAYAPDVVILIDYPGFNIKVAEFAHNNGIPVHYYIAPK
VWAWKEHRVKALKKFVDKLYIIFPFEREYFRSKGIEPHFEGNPLMDAIAERCAAAPEEDV
FRKENGLDERPIVALLAGSRVSEIKANLRFMAELAERMPDKQFVVAGVGWIAREQYEVFT
KDMPVKFVCDKTYELLQISEAAVVTSGTATLETALIGIPELVVYGIPWLYEKCKPYLLKI
PYVSLVNLNLQREAVREMVVYKPSVDEAEKELRSLLKGGAKREKMLADFEELREIIGGAG
ASDRFAKAIVDEIKN

Enzyme Prediction     

No EC number prediction in MGYG000003467_01586.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	4.1e-100	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.76e-94	1	375	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.97e-88	1	374	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.11e-60	4	356	2	362	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.04e-58	5	371	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.45e-36	1	369	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77950.1	1.74e-172	1	373	1	373
BBL11605.1	1.04e-166	1	374	1	374
BBL08813.1	1.04e-166	1	374	1	374
BBL00808.1	5.96e-166	1	374	1	374
BBL06737.1	1.75e-160	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.22e-34	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.35e-34	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.58e-59	5	374	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	6.18e-59	5	371	9	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	3.77e-57	5	371	11	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1INL4	1.07e-55	1	370	2	375	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q74AT9	2.23e-55	5	371	11	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003467_01586.