CAZyme Information: MGYG000003468_00174

Basic Information

• Species: UMGS1883 sp900768005
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1883; UMGS1883; UMGS1883; UMGS1883 sp900768005
• CAZyme ID: MGYG000003468_00174
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678		77315.04	5.1587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003468	911428	MAG	Fiji	Oceania

• Gene Location: Start: 700; End: 2736 Strand: -

Full Sequence      

MKKILFGISMSLLILMSLFSVATASSTTVSVDGHLVQFNKDTGYPFVDENSRTMVPLRIT
MESAGAEVGWEGTTRTASVNMNGTTVQVPIGHKYILRDGNKVEIDTSAVIKDGRTYLPIR
AVLESFGAIVSWDGAKKMVVVDTQASNSKIYRLENAKTINNFWNVYLEGVDAKSAGNYPT
AVQKLEQCLSSLLATDTKETVARVLGHLGEAYARNGQFSDADAAFQREAYYWGQVPGDDA
IQAKISAERKSLFMNQEMTLYVKTDDKTKALTKNFGAVHEPVNGALLGAFAEGEPLAHDK
NNIENKFYVYDFKNVAGKDHGIYLLYYPFGTNLSHYESHLSRAAEEGKIIELALEPYNGM
QMVYSNPDYLIRLAKDMEAHDCDFMLRFANEMNSDTNGWYTADANEYIEAFRYVAKIFRK
HAPSVPIVWSPLWYPPDNIDMYYPGDEYVDYVGMSSYQSWLSSVDPMGEDEDRRRWSQQL
DFFYKKYGYKKPMIIAEGGASYRNPWTWSDNLSDYATYQIQDFYTYLPMRYPNIKMVVYF
DYNGVKADGTVEPYAYQFTQHQNMWNAYKTVIRDEYYLTDISEGKNVKEYYYPVYGSKIL
PKVQELNLYVKYPKDRQNGVGRVEYFVNGNQVGTATQMPYSVNVDFSQYSGQNIEIKAVA
YDPWGYVINEKRFSAIVE

Enzyme Prediction     

No EC number prediction in MGYG000003468_00174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	372	504	2.8e-17	0.38943894389438943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	1.83e-30	49	141	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam07833	Cu_amine_oxidN1	3.32e-08	111	161	1	51	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
COG4124	ManB2	7.78e-07	391	506	189	307	Beta-mannanase [Carbohydrate transport and metabolism].
PRK14696	tynA	8.31e-06	54	117	1	64	primary-amine oxidase.
pfam17957	Big_7	2.55e-05	618	658	27	67	Bacterial Ig domain. This entry represents a bacterial ig-like domain that is found in glycosyl hydrolase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSX05302.1	3.84e-193	12	678	15	666
QNK58256.1	7.10e-93	161	678	35	538
AZN43604.1	1.76e-92	161	671	30	530
QHT63759.1	1.44e-88	163	678	4	507
AMY96565.1	6.33e-87	207	678	4	461

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999064	0.000177	0.000176	0.000152	0.000145

TMHMM  Annotations     

start	end
5	27