CAZyme Information: MGYG000003469_01403

Basic Information

• Species: Alistipes sp900768015
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900768015
• CAZyme ID: MGYG000003469_01403
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42894.36	4.9563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003469	1886287	MAG	Fiji	Oceania

• Gene Location: Start: 104918; End: 106060 Strand: -

Full Sequence      

MKRVVLTIVAALLAGVATLSAQQNLWQKDANVSPEIHADNSVTIRLYAPNAESVTLVGDF
VDNASMRCNAEGVWEYTSAPLASELYCYWFNVDGIDHVNDPMNSYVMRDVGSQMNYFIIP
GERGDLYAAQDVPHGTMSKVWAEVSDGRERRMTIYTPAGYEQGKGRYPVLYLLHGMGGDE
DAWSATGRVAEIMDNLIAEGKAEAMIVVMTNGCTKHVSAPGYSHEGMWRPYMSGSMDGSF
EAMFPSIVEWVDDHYRTKAKRSHRAIAGLSMGGFHSMQISKEYPAMFEYVGLFSAAIFRG
KEGVETYANTEAKLERQFQEGVKLYWIGIGKDDFLYDENVRYRELLDSEGYPYTYRESEG
GHIWRNWRIYLGEYAQLLFK

Enzyme Prediction     

No EC number prediction in MGYG000003469_01403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	147	374	1.8e-53	0.9427312775330396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.70e-30	131	380	63	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	4.77e-29	40	120	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	1.97e-20	147	368	5	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	1.31e-13	147	302	20	177	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG0627	FrmB	1.32e-10	134	373	16	303	S-formylglutathione hydrolase FrmB [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36651.1	1.97e-138	1	380	1	397
ADV42548.1	1.13e-137	21	380	19	397
ALJ59664.1	3.98e-137	1	380	1	393
QJE29438.1	5.24e-136	1	380	1	397
QKH98968.1	7.43e-136	21	380	19	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	1.03e-100	32	380	23	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.11e-53	34	380	40	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	6.58e-46	34	380	17	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	6.74e-46	34	380	17	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	6.02e-45	34	380	42	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.83e-39	31	380	326	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	2.51e-31	34	380	395	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	1.07e-30	35	380	42	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	3.18e-23	132	377	46	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P23553	5.66e-08	170	380	44	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000766	0.998347	0.000259	0.000225	0.000189	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003469_01403.