CAZyme Information: MGYG000003470_01263

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4372
• CAZyme ID: MGYG000003470_01263
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000003470_391|CGC1	43404.41	7.1817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003470	2121809	MAG	Fiji	Oceania

• Gene Location: Start: 5594; End: 6757 Strand: +

Full Sequence      

MKYFLIAGEASGDLHARHLMDAIRAKDAEAEIYYWYRPDLAYMGFISVAMHLPEILSGMQ
ECKKSISEFMPDRLILVDYPGFNLKIAAWFHKVFVEGRRGETTAVPQVVYYIPPKIWAWK
EGRIVQIKKYVDSILSILPFEVNWYAGKHDCHVDYVGNPTLDEISMFRNSLQAQEIEAWR
DALALGNAPVVALLPGSRRQEIERNLPMMLKAACAVGGDYQYVIASAPNMHKDFYEAIIS
SALGDGNGDFRKRIVLAPCQGSRSSFMLLDSAYAALVTSGTATLETAIFGVPQVVCYAMA
FGKVVSWLRKIVLKVPYVSLVNLIMGREVVPELVAGEMTHESVERNLRNVLVDETFRRNQ
KQGYETMMQLLGEPGAPEKAAHKIVGK

Enzyme Prediction     

No EC number prediction in MGYG000003470_01263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	372	3.9e-91	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.14e-87	1	385	2	372	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.70e-87	1	381	2	372	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.59e-70	4	373	2	361	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.45e-53	5	381	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.17e-40	1	342	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48683.1	6.13e-110	1	385	1	373
QUT34964.1	1.19e-109	1	385	1	373
AVM56429.1	1.23e-109	1	385	1	373
QUT60955.1	1.68e-109	1	385	1	373
QUT66360.1	1.68e-109	1	385	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.82e-25	5	362	11	364	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.82e-25	5	362	11	364	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.02e-56	2	385	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	4.45e-50	4	385	8	390	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
B4UHR6	1.71e-48	2	386	10	380	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
B8JE78	2.39e-48	2	386	10	380	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
Q2LVL8	9.16e-48	5	381	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003470_01263.