CAZyme Information: MGYG000003473_01233

Basic Information

• Species: UBA6857 sp900768075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA6857; UBA6857 sp900768075
• CAZyme ID: MGYG000003473_01233
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		89906.79	5.5793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003473	2233925	MAG	Fiji	Oceania

• Gene Location: Start: 24315; End: 26762 Strand: +

Full Sequence      

MKNSELISKMTLEEKVGLCSGKDGWYLKGVDRLGIPEIMLTDGPHGLRKANPEGKFKLEN
SVPATCFPPAVTSACSWNPELLYEMGVALGEECLQERVSVILGPGVNMKRSPLCGRNFEY
FSEDPLLAGELAASLINGVQSQGVGTSLKHFAVNTQEKKRLAINSVVDERALREIYLTAF
EIAVKKAQPWTVMSSYNKVNGTYSSENKHLLKDILRDDWGFEGIVVTDWGAANDRIAGIE
NGNELEMPSSKGFYDKKICTAVRNSKLSCDIIDESADRMLTLIRKSANALKDSYTYDKEA
HHCLAAKIYSESAVLLKNEESILPIGKDKKIAVIGEMARAPRYQGAGSSLINPTKISDAF
DALLKEGYTLNFAPGYNKKKDEIMPAMITDACKIAEKADIALVFIGLTEEYESEGYDRQH
LNLPMVHNYLLEEILKVNKNVVVVLSGGAPVTMPWLSKVKGLINGYLGGQASGDTIADII
SGKVNPSGKLAETYPLCLEDTPCYNYFPGTNRNAEHTESIYIGYRYYDTAKKDVLFPFGY
GLSYTEFEYSDLKLSKKKIKDTDTLTVTYKIKNIGNCDGAEISQVYIKDKQSTIFRPEKE
LRGFKKVFLKASEETTVEIELSKRAFAFYNAAESIWQVESGDFEIIVGASSRDIRLTADV
FVESTDNVPVPDYRESAPCYYSADIRSVPDKQFEAVLGHPIPARNYSAGERFDMTCSLGD
AADTKWGKIIIAMLETAIDRVIKGSETEKASVKANTFDVPIKNFITMGPDVLSEDVCNGL
LMLLNGEKSGKGLSKIVSGLTAAVKQLPNIIKKSN

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	248	5.9e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.26e-85	4	655	39	758	beta-glucosidase BglX.
COG1472	BglX	8.48e-70	32	335	57	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.80e-51	6	619	56	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.12e-49	313	544	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	7.32e-37	32	282	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53344.1	7.67e-287	1	787	1	788
AGS53563.1	1.48e-284	1	787	1	789
QEN03854.1	1.13e-277	5	785	7	793
CAJ35242.1	3.92e-274	6	800	8	807
QUG84566.1	1.54e-271	5	665	7	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.61e-259	5	665	7	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.41e-217	7	663	9	664	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.59e-144	2	656	3	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.99e-143	2	656	3	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.79e-125	5	663	8	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.98e-258	5	665	7	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.67e-217	7	663	9	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.07e-215	7	663	9	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.82e-149	5	657	48	740	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q2U8Y5	8.09e-132	7	665	10	833	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003473_01233.