CAZyme Information: MGYG000003477_00622

Basic Information

• Species: Acidaminococcus timonensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus timonensis
• CAZyme ID: MGYG000003477_00622
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000003477_80|CGC1	40836.76	6.5011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003477	1890782	MAG	Fiji	Oceania

• Gene Location: Start: 19063; End: 20199 Strand: +

Full Sequence      

MTNVFISAGEASGDLHAAALTRAILQQDPSAQVFGMGGEALAAAGGEVVFNYKEYSVMGF
VEVLKALPRLLGLKKAFRRLMEERRPDVFVTVDYPDFNMRVAKEAKALGIPVFSYIPPSA
WAWRRGRAKMVAGLCTKVACIYPFAARVYEEAGAPVEFVGNPLVDIVQPEMSPQEAEVFL
GKRPGHPVVLLLPGSRVKEITGVLPVMLQALPLIKKQQPDVDFVLQKAPSIDRDLLDSLL
ARSPEPVKVVEGHNYDVMTASDAALATSGTVTLEAALCGLPSVICYCASALSIFLARHLV
YVKYIGLPNILAGKEILPELIQENMTPERMASAVLAFLEPEGAATVRRELQQAVAKLGKP
GAVDRTAALILETAKEKE

Enzyme Prediction     

No EC number prediction in MGYG000003477_00622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	353	6.4e-121	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.11e-125	1	378	1	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.43e-109	1	376	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.40e-88	4	370	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	1.87e-47	1	328	1	307	lipid-A-disaccharide synthase.
PRK01021	lpxB	1.32e-39	2	352	227	584	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48042.1	1.48e-225	1	376	1	376
AEQ21864.1	1.77e-184	4	378	3	377
QTV78315.1	6.05e-141	1	378	6	383
BBG63223.1	9.59e-139	1	378	1	378
QNP77898.1	9.59e-139	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.86e-54	4	338	9	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.34e-53	4	338	9	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	2.29e-92	4	378	6	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	2.71e-88	4	377	9	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	4.31e-87	4	372	9	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	5.91e-87	1	372	1	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	4.72e-83	4	371	11	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003477_00622.