CAZyme Information: MGYG000003479_00054

Basic Information

• Species: CAG-312 sp900548275
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900548275
• CAZyme ID: MGYG000003479_00054
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000003479_3|CGC1	39961.22	9.9271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003479	2365803	MAG	Fiji	Oceania

• Gene Location: Start: 27173; End: 28270 Strand: -

Full Sequence      

MSKFIILCGGTGGHLAPGLAVGQALIKAGHEAGFVISRKQVDSRLVAKYKDLHIIKAPGI
AFSKNPAKFFSFLKELKNAVMFGKKLLEDGKYDAVVSFGGFNSLGVSLAAAWMGVPIVLH
EANRKAGKATRLLGRFAKRIYVPYGVKIPRRKSGQVKYSGYPIRDEIRRIPQNEAKAAFD
FAPDANILLVLGGSQGAAALNEWANENFAKLAERNVDVLCVCGQGKVKYENRSIQNSGGK
VRHLKFLEFCDNMAAAMSAANVVVARAGAGTIAELARIGVPSLIVPYPFAADNHQYENAK
CFEKHGGCVMLEQRNLDKLFDETMELFENTRLRESMEKNLVRVDDLNDTSKIADDLARIA
RRDAE

Enzyme Prediction     

No EC number prediction in MGYG000003479_00054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	340	5.5e-45	0.9363057324840764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	4.85e-88	3	354	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	1.00e-81	1	362	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	5.18e-74	3	362	2	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	5.86e-71	2	354	1	346	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	1.70e-27	187	340	1	154	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY35776.1	4.64e-105	1	360	1	360
AWT60195.1	4.63e-97	1	360	1	361
AWI07981.1	4.61e-94	4	362	13	371
ADE56085.1	2.11e-93	1	360	1	360
SDR67047.1	2.80e-93	1	360	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	9.77e-37	3	361	8	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	5.17e-33	5	316	13	321	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	5.79e-27	5	315	6	308	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1ZU31	3.20e-87	1	361	1	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) OX=452637 GN=murG PE=3 SV=1
A8F1I4	1.35e-45	1	342	1	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rickettsia massiliae (strain Mtu5) OX=416276 GN=murG PE=3 SV=1
Q4ULT6	5.04e-45	1	342	1	343	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=murG PE=3 SV=1
C3PND5	7.24e-45	1	342	1	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rickettsia africae (strain ESF-5) OX=347255 GN=murG PE=3 SV=1
Q92I58	7.24e-45	1	342	1	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003479_00054.