CAZyme Information: MGYG000003479_00321

Basic Information

• Species: CAG-312 sp900548275
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900548275
• CAZyme ID: MGYG000003479_00321
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000003479_13|CGC1	88996.64	9.0896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003479	2365803	MAG	Fiji	Oceania

• Gene Location: Start: 3680; End: 6052 Strand: -

Full Sequence      

MKKFAIITALAVSLVATTATAAENKFTPVKESPAIWANVPQSLKSARWLWRAYPYEAYEI
VNVYCLGRKTFDLESVPKKAPIFITADQSYRLFINGKFVCSGPARGYQFSQPFDEIDVAK
YLQKGKNVIAVRAYNAGRSTFSYLTQGYAGFIFALELGNGRNIVSDITTKVRTQEGCDRN
TAQLSIQMNNQEHIDLRVENPDWIQTGFDDSSWGKPSSRPYNAMPYYSMESRMIPMLEEF
EMKPEALVSRGSGKSVSNGERVFDVAKLFVAENIPHTMKTESVFEVEAKPSKDGVSSFVF
DMGRMCVGMPILEIDGAKGGEIVDMLATELLKDGTGNPVGGSQISAANRIICRAGKQRHM
FFNPFGVRYITVRVRNNPDSTIRVKPSLMWSAYPLADRGKFKTSNAYVDKIWQACKQTQK
ICALDAYVDTPYREQAQWWGDARVQSWNTFFISGDARLLRRGIRSISMQKVPNGLTYGHA
PTSSHHCILPDFSLTWMLTLYDYYWQTGSIEAYLSHRDTVESILSYFDGMTDPETGLVNA
DNRYWLFLDWTNIQKSGQPAILNLWLLEALEKMRKLCADNAISGDAKMYADRAAKVRAAI
EKNLVKKDGLISDGILPDGRQNPASSIHAQVLGKMTSIKGLDFEKAKREMLLPFLRGEKK
FKAMPSSFWVVYVLELMADEGYSAQVYDYIKRNWREFAEYGTAFENFDGKASHSHAWSAH
PAFLLPRILGGIRQKAPAWTEVSFKPNFFEDFAEIVYPTPQGDIKVSWRKNADGKFTSTV
DAPKSVSVSK

Enzyme Prediction     

No EC number prediction in MGYG000003479_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	297	787	2.6e-84	0.9742063492063492
CBM67	46	217	1.4e-36	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.23e-14	399	729	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.33e-12	77	213	3	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	6.35e-08	731	787	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	2.19e-05	452	602	56	208	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam05592	Bac_rhamnosid	2.68e-05	292	385	4	95	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT92885.1	5.25e-223	38	786	2	756
QYY35421.1	3.61e-221	40	786	11	761
SDU02729.1	5.92e-218	48	774	18	755
AHF89243.1	4.90e-214	46	774	19	775
QYM78626.1	1.82e-202	40	773	10	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	4.77e-48	45	788	7	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	7.84e-19	372	766	276	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	9.52e-09	68	783	180	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	9.33e-06	68	783	188	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999108	0.000154	0.000173	0.000158	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003479_00321.