CAZyme Information: MGYG000003479_00573

Basic Information

• Species: CAG-312 sp900548275
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900548275
• CAZyme ID: MGYG000003479_00573
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
926		103245.81	8.5707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003479	2365803	MAG	Fiji	Oceania

• Gene Location: Start: 30424; End: 33204 Strand: +

Full Sequence      

MKKLVSFFCAALFACGVFASDGAPAKPERLTAGEFFENPIGYNLDKLSFSWRLPDGAENA
KQTAYRIVTGRTPDVFSSVVWDSGKVLSDQSVHVPYGGKALDSRERIYWCVRFWNADGRP
SAWSDVAFAEAGLLRNSDWSGKWIFSPEPRVKKTLKIDRPPFRSEPVGDYVPPAYFRKET
ELGGGIASARLYVASRGVFRFFVNGRRVGGDCFGTGWTDYNIRIQTNTYDITKMLRSGKN
TFAAIIGDGWYSGKVGWDVNRRGRYGDRPELLAQVEIVFKDGSKKVVATDCSWKYSYGAI
VVSDIMDGEIYDARLEMDGWNANDFDDSQWRTPAEKNVEPKPLLEPRRNRMATVMDELTP
LSVRKIARGTYIFDLGQNMVGWVRIKIPAQRNKTVKLRFAEMLNKDGTLYVANYRSALSE
DYYTSAGGVRPDEWEPTFTYHGFRYVEVSGLPENIEARPDWLTGVVVYNDMPQTGSFVCS
NPKINRLQSCIQWGQRGNFLSVPTDCPQRNERLGWSGDAQVFCPTAAFNMDVSAFFEKWL
RDLADTADLHGAPADVAPYYPTGFGKAAWADAIAVCPWEMYMAYGDKKVLENYYPYAKSW
VEYMKRTSKNLVRPATGYGDWLQPNGKADSSASDAPKDLIGTAYFVRSADLASKMAIVLG
KDGDAKQLATLAGDVRAAFMKAYVSPDGTVKSDSQTAYLLTLGFDIAPENMRAKIFEKFL
AALKRDGCKLNTGFVGTPLLNPVLTRFGRTDLAYRLILNECYPSWLYPLNQGATTMWERW
NSYSHENGFGSARMNSFNHYAYGAIGQWLYKDVAGIWYDENNAGYGNVVYAPKIGGGLTF
AAGSHETPYGSASSSWRVSDGVMEWTVVVPQNAAGTIVFPTKNLGSIRVNGNPLAESAFS
FEGGYPALRNVSGGTYRILLRPQIIK

Enzyme Prediction     

No EC number prediction in MGYG000003479_00573.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	363	878	5.6e-173	0.996031746031746
CBM67	171	335	2e-36	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.28e-141	472	813	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.43e-62	186	348	3	164	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.84e-38	364	468	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.15e-13	823	881	7	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ91107.1	2.66e-260	34	918	12	886
QDU57486.1	3.71e-258	11	887	10	854
ABU57965.1	4.24e-258	34	918	12	885
QTN32967.1	1.74e-257	16	882	15	964
QDT68743.1	2.39e-257	23	921	15	980

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.73e-208	34	880	12	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.75e-167	34	880	38	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	8.01e-165	32	882	8	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	4.85e-232	26	890	34	889	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.09e-210	26	880	30	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	6.50e-208	34	880	12	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.87e-116	38	891	42	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000551	0.669037	0.329737	0.000243	0.000224	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003479_00573.