CAZyme Information: MGYG000003479_00868

Basic Information

• Species: CAG-312 sp900548275
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900548275
• CAZyme ID: MGYG000003479_00868
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000003479_34|CGC1	39733.23	8.023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003479	2365803	MAG	Fiji	Oceania

• Gene Location: Start: 32224; End: 33279 Strand: -

Full Sequence      

MMLYKIIKHSPNPTKHRVVSLIAEGFFAQKIRELGCVVESLDMTKNPLTFSPFHILRIIK
DARPDIIQCWMFHANIIGGFFGRLSGVKNIVWGIHHSMSKYDRRISHLINKIGALMSHNF
CDTVICCGLRPLEVCKNSGYAADKLKCVYNGFEPDVFFFDENARKKIRTELGLTDDAFVV
VHMARFHILKNHLGLLRIFAKLLAKNHNSYLVLVGDGLAGNEQIENAIDELGIRTNVKMM
GFRTDSCAFYSAADVTVLPSLSEGFPNVVGESMLCERPCITSAVGDCANITGHRDWAFEL
SDEDGFAEKLFEFSKMPKSELKACGEECRKRIVDNFDIKKIYSEYSKIWCK

Enzyme Prediction     

No EC number prediction in MGYG000003479_00868.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	176	317	5.2e-27	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03807	GT4_WbnK-like	8.53e-85	2	349	17	361	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd04951	GT4_WbdM_like	5.84e-49	37	349	51	358	LPS/UnPP-GlcNAc-Gal a-1,4-glucosyltransferase WbdM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after WbdM in Escherichia coli. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.
cd03811	GT4_GT28_WabH-like	4.13e-44	15	341	29	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03808	GT4_CapM-like	6.88e-43	24	346	37	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	2.02e-38	15	349	31	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI28215.1	2.89e-60	1	349	20	371
QDY75137.1	2.97e-60	1	349	20	372
AOL35919.1	3.22e-60	1	349	20	372
QOR84158.1	3.65e-60	2	349	1	351
QNU23257.1	7.24e-60	2	349	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XSO_A	1.77e-14	18	293	37	324	ChainA, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSO_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	4.53e-16	56	293	82	324	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
Q9R9N0	4.05e-14	57	327	73	317	Lipopolysaccharide core biosynthesis glycosyltransferase LpsD OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsD PE=3 SV=1
P71055	4.17e-13	46	282	71	308	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
D2B9F4	3.01e-07	139	301	201	383	D-inositol 3-phosphate glycosyltransferase OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) OX=479432 GN=mshA PE=3 SV=1
C7QKE8	7.00e-07	140	288	189	347	D-inositol 3-phosphate glycosyltransferase 2 OS=Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908) OX=479433 GN=mshA2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003479_00868.