CAZyme Information: MGYG000003480_01049

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000003480_01049
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000003480_76|CGC1	38489.11	4.7851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003480	2592239	MAG	Fiji	Oceania

• Gene Location: Start: 24009; End: 25046 Strand: -

Full Sequence      

MKKIFMYMFAFVAAISSMTSCDDWTDTEIKNPADLTHSNKTEAYYQQLREYKKTDHQVAF
GWFGNWTGTGLSLENSLAGLPDSVDFVSIWGNWRNLSIEQKADLQFVQQVKGTRALMCFI
VQSVGDQLTPEGTDAATFWGTGDEAIAKYANAICDSIDKYGYDGFDWDYEPNYGHRGDIS
GVPAAEKVFAETMAKRIGPKSGTNKLFVIDGEPQSVNKELGPCFNYFIVQAYSCWGAGDL
DSRLSSTISNFDGVLSAEEVAKKYIVTENFENFAKAGGVKFTDRRGNTMQSLEGLARWTP
MVDGKYVDKAGCGTYHMEYEYNVSGFGTTYPYLRKAIQIQNPSVK

Enzyme Prediction     

No EC number prediction in MGYG000003480_01049.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	1.57e-94	25	339	1	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	4.99e-68	57	326	1	247	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ56874.1	2.32e-161	1	345	1	354
ALJ45245.1	2.32e-161	1	345	1	354
SCV09578.1	2.32e-161	1	345	1	354
QDM07872.1	2.68e-160	1	345	1	354
QUT81795.1	2.68e-160	1	345	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	3.31e-72	3	341	2	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	1.03e-17	32	270	7	227	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	1.22e-16	32	270	7	227	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	2.58e-11	48	318	52	305	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000256	0.999768	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003480_01049.