CAZyme Information: MGYG000003480_01096

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000003480_01096
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		97654.33	6.8113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003480	2592239	MAG	Fiji	Oceania

• Gene Location: Start: 14629; End: 17217 Strand: +

Full Sequence      

MTNYQNKPNYNMINSKFLLSAMFAMACSATVFAQDDSFDLSSQRGEKQDVNMVPGKKINH
HGIIVNPTPHNFSVDAQQLIDLSQGVNVVDKQKKFANDLGFVKQDKKGVKLTIDFGKKAA
QKAGLKKMVSGAYLLTADNNGINIVGYDERGAFYALQTMRQLLDSPATGGKMPYTQCNDY
PDLPLRGVVEGFYGEPWSHQVRLSLIEYYGRNKLNEYVYGPKDDPYHSSPNWRKPYPEDQ
ARNIHELVEACNRNRVDFVWAIHPGKDIKWNEEDYQNLVNKFNHMYDLGVRSFAIHFDDI
EGEGTDSNKQVDLLNRLTKEFVKTKSGVAPLVVCPTDYSQLWASPKENGQLAIYGKRLDP
SINVFWTGAVVCSDLDKATLNFVDSRIKRPAYYWWNFPVTDYARHIIMQGPAYGLENDIT
DQMTCGVLSNPMEHGEASKLALYGVADYNWNVKDYNPIDNWERGLVDLTPEAHDAYRTFA
IHSCDTETGYRRAESWETRTFRLSDYTDAKASALKNEFEKVEKAPDTMERDCKNPLLMKE
LRPWLVEFKKLGKRCNTTLDLMKEFRSGNYASFWSNYLRNRMTNADLTAYQAHKSGTMKL
QPFYENGMDDMAVEFFHKIAGKTPAFYNAVGTYATLRTTQSKLMLDGDIKTFYHSGNSQN
TGDWIGLDLGAVRPVREVRIIQGRNSVDDVDYFDNTILEASADGKTWTALTGELPKTYEI
NWKGEPVEARYVRMRKLQSEKKSWCAVREFIVNPTTPESLPFKVEAADVNAAMPAFDENP
CTSFNNAGKLTFGIENGTVSYTLLTDKAMAKGNVVFNQYNKKGKLISSTPVDNSLMSVNV
VKKAVKAELEGSVEVFEIIANK

Enzyme Prediction     

No EC number prediction in MGYG000003480_01096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	186	480	2.4e-103	0.9932203389830508
CBM32	640	750	2.3e-16	0.8387096774193549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.09e-159	186	479	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	6.27e-11	60	179	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	9.24e-11	645	750	18	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	3.16e-07	646	748	30	138	Substituted updates: Jan 31, 2002
smart00231	FA58C	8.72e-05	645	733	28	120	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB75783.1	0.0	31	860	23	851
AHF11939.1	0.0	16	862	6	855
BCI62100.1	0.0	12	859	3	852
ADV43394.1	0.0	16	861	5	849
BBL05673.1	0.0	12	861	1	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	2.66e-137	71	752	27	722	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2VVN_A	3.53e-137	14	752	4	732	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	1.04e-136	71	752	15	710	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	1.07e-136	71	752	16	711	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	1.07e-136	71	752	16	711	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.93e-136	14	752	4	732	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	7.40e-87	133	734	133	741	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.93e-86	133	734	133	741	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	6.83e-53	132	753	133	795	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	5.96e-33	164	448	40	331	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006477	0.319939	0.669470	0.002402	0.001022	0.000667

TMHMM  Annotations     

start	end
12	34