CAZyme Information: MGYG000003480_01192

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000003480_01192
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42730.57	5.9564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003480	2592239	MAG	Fiji	Oceania

• Gene Location: Start: 519; End: 1646 Strand: -

Full Sequence      

MRHIKTAFIGFGYRGKQMLRLLRTIDFFDIVGIADKNDCQEKNSLGAPFYQGEEAFKTML
EEQHPELVFITTPWHLHVPQAVECMRHHCHVALEIKGGLCHDEYAPLAEIANTEGLRVFP
LENTLFMREILAIKRMADEGVLGEIVYMRGGYRHDLRDILLDDKGILGGRKGTESVWRSR
FYTHNNGDIYPTHALGPLCMILGIGKNDQLAWLTSFATKAVGLRQRMSEHDATTITLGDI
VSTQIETKGGTLISLTHDTTLPRPRSLDFEVQGSRGIWDGVNRRIYIEGMNNQEQWEDDA
EYIKKYKSTYWQLWGEEALNNDSHHNGMDYIMLRAIESDLTGQTPYPATLSDLALWTSVT
ILSEESIKEHSRVAF

Enzyme Prediction     

No EC number prediction in MGYG000003480_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	372	1.4e-106	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.26e-22	1	374	1	339	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.80e-10	4	94	1	92	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1086	FlaA1	0.009	3	73	116	186	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC [Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT33801.1	9.18e-158	1	373	1	376
QQA30653.1	9.18e-158	1	373	1	376
QUT62197.1	9.18e-158	1	373	1	376
ADV42950.1	4.32e-155	4	373	10	382
QRO24037.1	5.26e-140	1	367	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.50e-66	2	373	19	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.72e-41	4	369	43	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	3.20e-68	2	367	32	424	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8F7	8.21e-66	2	373	19	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	7.73e-61	4	367	53	442	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	8.97e-58	4	367	50	440	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4FN60	3.33e-55	4	371	61	433	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003480_01192.