CAZyme Information: MGYG000003482_01367

Basic Information

• Species: Selenomonas_C bovis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_C; Selenomonas_C bovis
• CAZyme ID: MGYG000003482_01367
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	MGYG000003482_19|CGC3	49444.98	6.1911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003482	2265437	MAG	Fiji	Oceania

• Gene Location: Start: 117884; End: 119224 Strand: -

Full Sequence      

MKRKHAIGLLALLLCTAPSYVLASPADDPDDPAYVAKTAVADTVKAKAEAPTLAALAAKA
PREVTLVDRKAMPETAALYQYLAALPQTGHILYGHQNDVHHKMFLTDSGSTSDTQDMTGS
IAAVVGMDALSLTGAELTLTPAERKAGLTYTAKLVKISEAAHRQGAILTMSMHMPNFAEV
AKKGQKNGAWDYSGYSPNNLTGNVGHRILPGQDLNAIYNGYLDLVADYLLQLQAKGTPVI
FRPLHEHNGSWFWWGGGNIDEGDFLELWHYTVKYLRDTKGVHNCLYAYSPNGPFFDEGAY
LSRYPGDRYVDILGVDTYNDEQKPEWFTNLDKTFTVMQKAAKEHGKLIALTEAGVRDGGA
LPVTENRDKRWFQDVTAVCLKHQVPFFLTWANFEKLEHNFFEPYMVSDTRGHEMVNDFID
FYNEPSTIFADGVADFTKLPAPVRKN

Enzyme Prediction     

No EC number prediction in MGYG000003482_01367.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	67	373	7.5e-61	0.8382838283828383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.25e-43	67	394	1	286	Glycosyl hydrolase family 26.
COG4124	ManB2	3.40e-19	207	378	145	324	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83629.1	3.10e-184	1	441	1	444
AME03684.1	1.68e-165	8	445	14	453
AKT53686.1	6.81e-165	23	445	29	453
AOH46966.1	3.16e-163	1	445	10	453
BBK75947.1	1.03e-131	61	443	289	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YN5_A	4.85e-57	66	429	51	414	Catalyticdomain of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase [Bacillus sp. JAMB750]
2BVT_A	4.37e-52	60	444	2	372	Thestructure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVT_B The structure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVY_A The structure and characterization of a modular endo-beta-1,4-mannanase from Cellulomonas fimi [Cellulomonas fimi]
2X2Y_A	3.25e-50	60	444	2	372	Cellulomonasfimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi],2X2Y_B Cellulomonas fimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi]
1J9Y_A	4.77e-50	61	392	6	324	Crystalstructure of mannanase 26A from Pseudomonas cellulosa [Cellvibrio japonicus]
1R7O_A	6.02e-50	61	392	16	334	CrystalStructure of apo-mannanase 26A from Psudomonas cellulosa [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	6.18e-49	61	392	44	362	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	9.18e-48	35	446	9	412	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P16699	5.35e-19	164	321	123	273	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
O05512	1.17e-18	163	318	121	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	5.16e-18	209	318	158	266	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999048	0.000202	0.000176	0.000155	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003482_01367.