CAZyme Information: MGYG000003482_01949

Basic Information

• Species: Selenomonas_C bovis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_C; Selenomonas_C bovis
• CAZyme ID: MGYG000003482_01949
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	MGYG000003482_31|CGC3	30561.9	6.1255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003482	2265437	MAG	Fiji	Oceania

• Gene Location: Start: 105867; End: 106697 Strand: -

Full Sequence      

MQEQTTLAAAVSYTGIGLHSGRDVHMRLAPAPVGTGIVFVRTDVAGRPTIRATADHVTST
LRATTLEEHGVRVFTVEHLMSALHARRIDNCYVELDSEEPPVADGASLAFCRLIGEAGVE
AQGAPREEIVIDKVYRIDDDERQRFVMVVPYDGFRVSFTSVNPHKLIGIQYENFEITPET
YEKEIAPARTIAYEEEIKKLRAMGLGLGGTLETVIVYNDERWLNPLHYEDELVRHKILDV
IGDLRLAGMIRGHVIAAASGHALNTALAKRILAARR

Enzyme Prediction     

No EC number prediction in MGYG000003482_01949.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	272	2.3e-93	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	5.64e-138	4	273	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	1.04e-125	1	273	1	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	1.65e-112	1	276	1	280	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	2.85e-95	1	271	2	298	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	2.90e-86	4	276	3	276	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84307.1	3.29e-150	3	271	2	270
SNU94334.1	3.45e-124	1	273	1	271
AKT54920.1	4.08e-124	1	275	25	297
AOH48620.1	1.35e-123	1	271	1	269
AEC00860.1	8.07e-123	1	271	1	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J3D_A	3.54e-59	1	273	1	276	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	3.74e-59	1	273	1	276	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	4.19e-59	1	273	1	276	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
5UPG_A	4.31e-59	1	273	2	277	Crystalstructure of LpxC from Pseudomonas aeruginosa in complex with PF-5081090 [Pseudomonas aeruginosa PAO1],6C9C_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with racemic ligand PT803 [Pseudomonas aeruginosa UCBPP-PA14],6CAX_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT805 [Pseudomonas aeruginosa],6DUI_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT801 [Pseudomonas aeruginosa LESB58],6E54_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with ligand PT802 [Pseudomonas aeruginosa PAO1]
2VES_A	5.29e-59	1	273	1	276	CrystalStructure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_B Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_C Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],3P3E_A Crystal Structure of the PSEUDOMONAS AERUGINOSA LpxC/LPC-009 complex [Pseudomonas aeruginosa],3U1Y_A Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3U1Y_B Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3UHM_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase in complex with inhibitor [Pseudomonas aeruginosa],4LCF_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-014 complex [Pseudomonas aeruginosa PAO1],4LCG_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-050 complex [Pseudomonas aeruginosa PAO1],4LCH_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-051 complex [Pseudomonas aeruginosa PAO1],4OKG_A LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],4OKG_B LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],5DRQ_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-040 complex [Pseudomonas aeruginosa PAO1],5DRR_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-058 complex [Pseudomonas aeruginosa PAO1],6I46_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I47_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I48_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_BBB Chain BBB, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I4A_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],7CI4_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI4_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_C Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_D Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI7_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI9_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIA_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIB_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CID_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7DEL_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEM_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEN_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2IPK1	1.03e-66	4	273	6	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxC PE=3 SV=1
Q2S9Z8	1.56e-64	1	272	1	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Hahella chejuensis (strain KCTC 2396) OX=349521 GN=lpxC PE=3 SV=1
B7J3W7	4.67e-64	1	272	1	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=lpxC PE=3 SV=1
B5ELD7	4.67e-64	1	272	1	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31) OX=380394 GN=lpxC PE=3 SV=1
Q1D2K0	1.76e-63	4	272	8	277	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003482_01949.