CAZyme Information: MGYG000003483_00554

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_00554
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		44119.52	8.5265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 32911; End: 34059 Strand: +

Full Sequence      

MKKLILAAALAAMALAPAPAKDWPGFTRGMGIGGWLTNYKRFNVLPESRRLKITVGDLEH
FDTYITERDIANIKAMGFDHVRLGFDQIVLEEAPGRYRERTFRKIDDFIAWCEKHGLNMV
LNLHKAVGNYCDIAEKVQLLDDKGLQDRFVALWLEFERRYHGKPGLAFELLNEVRNVDPE
KWNALADRTLKAIRERNPARWVVVGSTCWNAAGTLDKLKIWDDDRVVYTFHMYAPYEFTH
QRGVLQAGPLYYNRVMEYPTKDVERYRDYNRLVNGSKTGGYEGLTEIGRQYIRNCLHGAH
VFTQKHPDKILWNGEFGTIRHAPPASRVAYMRDVIATCREWGIPYCVWNYLSTPNDGNRF
SLVDDDTRRILSPELLKACLGE

Enzyme Prediction     

No EC number prediction in MGYG000003483_00554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	57	351	1.7e-80	0.9424920127795527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.89e-26	62	241	22	203	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.37e-12	60	358	69	369	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45789.1	7.86e-141	22	382	3	363
AOA60286.1	8.40e-64	22	377	3	338
AIQ42917.1	7.61e-63	22	352	3	316
ACH67609.1	1.48e-61	20	378	2	341
QUL53328.1	9.22e-61	21	352	2	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	3.39e-60	26	376	4	335	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	9.46e-60	26	376	4	335	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	2.43e-26	73	381	42	312	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AOF_A	3.35e-26	73	381	42	312	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]
3AMG_A	1.67e-25	73	381	42	312	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	3.36e-60	26	376	4	335	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	3.36e-60	26	376	4	335	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	2.61e-59	26	376	4	335	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	4.29e-37	25	241	6	210	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P25472	7.34e-20	72	262	64	256	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000315	0.998806	0.000241	0.000205	0.000204	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003483_00554.