CAZyme Information: MGYG000003483_01070

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_01070
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1063		117387.27	8.2419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 43374; End: 46565 Strand: -

Full Sequence      

MKNCIAACLVAAALAGAGANDPTDYKKTVQRRVAPVAVKGLAAGGTLADFGQEAFGFLEF
TPPKGTRGAYEVWLGELVTPEGGVNRKPGATIRAVRVAGTIAADGVHRVPLPPDARNTSG
GREGGAIPIPPEHGVILPFRYAEVVRAPFTVTREMVRMVAVNYPIDMAASAFTCDNADLV
KVYDFCKHSIRATSFAGLYVDGDRERIPYEADAYLNQLGDYAVHPDPSLARASLVYLMAH
PTWPTEWKQHAIKMAWADWMWTGDTRALAQFYGQLKDEKLLTRFRRADGLLRTGGERLPH
ALTNACGAADIVDWPPCERDGFVFRDVNAVVNAFHYRNLLEMADIARALGRTADAAAFAA
DARTVHAAFQKVFFDPARRVYRDGEGTDHASLHANAAALAFGLVPRAHRREVVSFCASRG
MACSVYFAQYLLEAFFEAGRADLALALMTATGDRSWLGMLDQGATITMEAWAPKYKPNLD
LNHAWGTAPLNVLARYVLGVTPLEPGFGKIRIAPQVGDLRHVAGTVPTARGPVKVSVVDN
EVLTVETPAPARIEFAGQVREVGAGRHVVRLLEAGLDPAAAWRPSVRWRGFNLLEMFIKG
GNAKPREFREEDFQMMRDWGFNFARLPMDYRYWIKDGDWERFDEDHLAYIDRAVALGRKY
GIHVNLCMHRAPGYTVARPPEETDLFTDPETQRVCAKHWAMFARRYKGIPNEQLSFNLFN
EPPNVADAAYGRIAKILIEAIRREDPARFIVADGLSWGRRPVKALAGIPGVGQSTRGYTP
MSVSHYMASWVGTPTAKPVWPIRLDAPNGILAGRGKGEMHAALVVSNLPPCRLRLSYGRV
SGRVKVRFTADGTTVAEDVFAPQTNSPLWTSVQWYPEWKIFQGSYRGESVVALPQGARGL
EVRIVEGDWATPETLTVTAGAHAAALAFGADWCRPVNFVQDFRGFDAPAPFVAVGAAVAA
PRYADAGMEYLYRKLMVPWDEACAAGTFAFVGEFGCYKYTPHALVLDWLEDYLRLWKERG
MGWAMWNLRGAIGILDSGRSDVEYEDFRGHKLDRKMLDLLLKY

Enzyme Prediction     

No EC number prediction in MGYG000003483_01070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	41	551	1.2e-99	0.9761904761904762
GH5	590	803	9.9e-80	0.7560975609756098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.05e-49	169	497	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG2730	BglC	2.13e-14	586	804	50	260	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	3.15e-13	610	798	27	206	Cellulase (glycosyl hydrolase family 5).
pfam17390	Bac_rhamnosid_C	2.52e-05	499	549	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF92863.1	2.49e-153	16	535	115	639
AHF91224.1	3.78e-142	34	570	34	566
QNN25199.1	1.41e-141	49	569	160	703
QTN33686.1	2.70e-139	35	535	33	526
AWB66196.1	2.53e-135	37	559	173	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC9_A	4.05e-62	587	1063	19	341	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	1.55e-59	587	1063	19	341	Crystalstructure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
3W0K_A	1.88e-43	590	1062	5	327	CrystalStructure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
3CIH_A	5.46e-11	35	546	183	684	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	7.34e-115	49	556	610	1135	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
P16169	5.42e-11	609	798	32	220	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000334	0.998906	0.000222	0.000181	0.000163	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003483_01070.