CAZyme Information: MGYG000003483_01359

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_01359
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		67615.06	7.5923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 35419; End: 37269 Strand: +

Full Sequence      

MNDVLSRCTGFVLVGAALLLACGARAAAFEKVVKGTVAGDVRVSSRDAGGWTFACERRSL
GAGVDEIEVSLSAAAEARPPSFKVSWAVPQRDIQAFWTPQDGGTCVIPPDWGGGKSSDFA
HWSPVGALISDRNRNRLSFAADEAHRVVYYAAGLKETTCELTCSMSFLTGVEAPLASYAV
RIRLDARDVFWSDAVREASAWISSKPGNAPCVAPAAAFKPLYSSWYCFHHNVFAKDIEEE
CARAAKLGMKTLILDDGWQMDDVVGGYSKAGDWQISTRRFPDMAAHVRRVQAMGLKYMLW
YSVPFIGTKTANYARFKGKYLYETLGAGVLDPRFPEVRAFLAGVYEKALRDWNLDGFKLD
FIDCFHIKGKDPAEAENYSGRDTKSVEEASDRLLGEVMARLKAIKPDLLVEFRQAYVGPA
ILKYGNMFRVADCPGDKNRNRRGIARLRLTSGPGAVHGDMLEWHPDEPAEVAARAVLDSI
FGVVQYSMMLRKLPESHTAMIRHWAGFSTRHEDALLHGTFRAYNPEHGYPVLEGASANER
ILGAYLAGFCVDGGAPDRETFVLNGTGENRLVLRVHAAPRRVQAFDTFGKEVPAPSLAVG
VNEVPVPCSGYLRIAY

Enzyme Prediction     

No EC number prediction in MGYG000003483_01359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	219	523	1.2e-30	0.4491279069767442

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	7.02e-58	220	507	4	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	4.40e-12	219	361	2	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	1.65e-11	244	518	67	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	4.89e-09	222	323	5	105	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG1501	YicI	3.01e-07	227	378	268	436	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	5.53e-175	47	616	15	587
QHW35515.1	1.07e-148	63	610	32	580
QSF42796.1	5.39e-146	60	614	30	588
QTH41069.1	1.82e-144	63	615	33	589
AIQ58516.1	6.13e-143	63	614	32	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	3.28e-06	221	411	332	516	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001384	0.323867	0.673433	0.000681	0.000353	0.000276

TMHMM  Annotations     

start	end
7	29