CAZyme Information: MGYG000003483_02166

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_02166
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000003483_113|CGC1	57703.57	6.2251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 3719; End: 5257 Strand: -

Full Sequence      

MAVRRQGQKGTNPRILIVTPEITYLPEGMGNLAGKMSAKAGGMADVSASLVAALFDLGAD
VHVALPHYRRMFHEETAQLVDSELRVYKSRMPDEHIHLAEDRCFYYRDRVYSQSGANPRL
SLAFQREVINHIIPEVQPDLIHCNDWMTGLIPAASRRMGIPCLFTVHNIHTHKLTLAQVE
DAGIDAAEFWGNLYYEYPPADYFSAHDTDPIDLQASGIFAAHFINTVSPTFLKEIVNGWH
SFIPDSIRNEIRNKYNAGCATGILNAPDPADNPATDDKIPFRYGPADHAEAKRKNKMELQ
RALGLEVNPDAPLFFWPSRLDPVQKGPQLLADICYRFLDKHWSKGAQIAIIANGAFQKPF
WDIRSFHGIERRLGVRDFDGRLSQLGFAGSDFMLMPSLFEPCGLPQMQAPIYGSLAVVHN
TGGLHDTVEPLDVDAHTGNGFVFDTYDSNGLFWAMDQAMAFWNRPAEVRATEIARIMDES
LKRFNHEICARQYIALYERMLHRDLVKDFSET

Enzyme Prediction     

No EC number prediction in MGYG000003483_02166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	14	498	1.9e-104	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00654	glgA	2.58e-100	14	503	2	466	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	5.59e-99	14	499	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	5.92e-87	14	499	2	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.06e-78	14	501	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
PLN02939	PLN02939	1.31e-41	31	503	486	970	transferase, transferring glycosyl groups

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44236.1	1.17e-234	3	507	2	505
QSH42549.1	1.46e-232	8	506	4	503
AKJ63772.1	1.30e-229	5	509	4	508
QBG47428.1	8.79e-229	13	512	30	530
QTN34057.1	3.94e-221	9	507	6	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	5.61e-39	31	503	14	500	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
2QZS_A	3.39e-37	39	500	15	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3D1J_A	4.14e-37	39	500	15	476	ChainA, Glycogen synthase [Escherichia coli]
3COP_A	2.25e-36	39	500	15	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	9.53e-25	144	460	269	588	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1YK70	1.66e-47	39	497	15	475	Glycogen synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / CIP 109462 / JCM 13490 / 255-15) OX=262543 GN=glgA PE=3 SV=1
Q7NM37	1.93e-46	38	503	14	456	Glycogen synthase OS=Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) OX=251221 GN=glgA PE=3 SV=1
Q2RH55	4.64e-46	14	503	6	478	Glycogen synthase OS=Moorella thermoacetica (strain ATCC 39073 / JCM 9320) OX=264732 GN=glgA PE=3 SV=1
B3PGN5	1.10e-45	39	500	16	479	Glycogen synthase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=glgA PE=3 SV=1
Q3A0B8	4.28e-45	38	499	14	477	Glycogen synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003483_02166.