CAZyme Information: MGYG000003483_02470

Basic Information

• Species: RUG572 sp900547945
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900547945
• CAZyme ID: MGYG000003483_02470
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000003483_128|CGC1	81668.36	8.4216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003483	3685575	MAG	Fiji	Oceania

• Gene Location: Start: 1020; End: 3242 Strand: -

Full Sequence      

MPAALLLVAGSSLPPGMFWRAMDPRRPRRVARWGDAAEYAKLFRIMKIQLVCLSSFAALC
AGAKFIEAHVETRAPVQVKTEAVAGKAPSLLPPGKKWTLVWHDEFDRKEIDRTKWMCRES
FWGYDFPAFAHGFEGVEMTGETVKLNLIRKGDDFTSPHLQTGSLTYDIPRDTSGFWPFGK
RKKPLFMKKYGYFEIRCRQPKNPGWHAAFWLQAPGVGSHPDAGVCGVETDIMENYQQFTK
GKIVGGNGWGGYGRDSCWYDHFEWTHEETPDGWHHYGCDWTPEGYTFYCDGKKVGEQNYP
VSHVPQFLLVSTEPGGYRKAGSDGGLTAGRNAKSWGTPDPRLFKARLPDCFEVDFVRVYD
AAPVPEPPLAHPAEPALRAWADAAWARVMATFYSPKTGGIYITAPDKVNPAKDFPGGLLK
PEFGYGTGLEDCAINGGVALSGLVDKWLVTRDAATAADAAKIARGLLNLATAHPYKGFVA
RGLCVEDGTSICRLSSRDQVTHWMHGLFRYVAADGLAPDALKREIRAAFAAVAARMARTV
TQANDWNFLQADGTPDPRGICKMREVQPHEAARLAMVYALAGKVTGDAHWTQLYRTHRAE
ALEGSCALGTCPDSVVRNLMPDYTLIQMNTSLEAILAVETDEKYRAKAIGAMVTCARLAR
ERAPRIAGADTRYLCGCAEVHLAQMMVPQGAFAYGPYQRALLANAITHVPAETVGATRAC
HLFAAYWRAKRLGLWTEGAR

Enzyme Prediction     

No EC number prediction in MGYG000003483_02470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	101	359	2.7e-25	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	4.93e-20	103	359	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	2.94e-15	101	359	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	3.57e-15	91	359	13	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
pfam00722	Glyco_hydro_16	5.44e-08	162	327	11	163	Glycosyl hydrolases family 16.
cd02177	GH16_kappa_carrageenase	8.38e-06	93	360	4	269	Kappa-carrageenase, member of glycosyl hydrolase family 16. Kappa-carrageenase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of kappa-carrageenans, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Carrageenans are linear chains of galactose units linked by alternating D-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Depending on the position and number of sulfate ester modifications they are subdivided into kappa-, iota-, and lambda-carrageenases, kappa being modified once. Carrageenans form thermo-reversible gels widely used for industrial applications. Kappa-carrageenases exist in bacteria belonging to at least three phylogenetically distant branches, including pseudoalteromonas, planctomycetes, and baceroidetes. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY34338.1	7.50e-107	78	361	1	287
AQT67838.1	1.16e-30	91	360	283	506
ASV76034.1	2.55e-28	91	359	51	273
AQT67867.1	6.67e-26	90	360	381	605
AXE18609.1	4.15e-24	97	359	56	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VY0_A	7.88e-10	94	359	10	259	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
3WVJ_A	3.93e-08	162	315	45	188	ChainA, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DBX3	5.80e-07	162	315	74	217	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
Q84C00	1.02e-06	162	315	74	217	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.986845	0.012156	0.000433	0.000077	0.000039	0.000439

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003483_02470.